PDB entry 1vvk

View 1vvk on RCSB PDB site
Description: Structure of the Methanococcus jannaschii ribosome-SecYEBeta channel complex (SecYEBeta + 50S ribosomal proteins)
Deposited on 2013-06-17, released 2013-10-23
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: 9 Å
R-factor: N/A
AEROSPACI score: -0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '7':
    Compound: Preprotein translocase subunit secE
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
  • Chain '8':
    Compound: Preprotein translocase subunit secG
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 50S ribosomal protein L19e
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VVK (0-149)
  • Chain 'S':
    Compound: 50S ribosomal protein L22P
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VVK (0-149)
  • Chain 'T':
    Compound: 50S ribosomal protein L23P
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VVK (0-83)
  • Chain 'U':
    Compound: 50S ribosomal protein L24P
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VVK (0-120)
  • Chain 'W':
    Compound: 50S ribosomal protein L29P
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VVK (0-End)
  • Chain 'X':
    Compound: Protein translocase subunit SecY
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: 50S ribosomal protein L39e
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VVK (0-50)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '7':
    Sequence, based on SEQRES records:
    >1vvk7 (7:)
    mktdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpat
    yikgilk
    

    Sequence, based on observed residues (ATOM records):
    >1vvk7 (7:)
    tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
    kgilk
    

  • Chain '8':
    Sequence, based on SEQRES records:
    >1vvk8 (8:)
    mskreetglatsaglirymdetfskirvkpehvigvtvafviieailtygrf
    

    Sequence, based on observed residues (ATOM records):
    >1vvk8 (8:)
    etfskirvkpehvigvtvafviieailtygrf
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >1vvkQ (Q:)
    mntlkmqrriaaeilkcgenriwidperiddvasaitredikrlikegvikkkpikgqsr
    yrakirheqkkkgrhrgpgsrkgkktarmgkkelwiktiralrkelrklkaqkkidrkty
    rmlyirakggqfknkhqlylfleehgllkk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records:
    >1vvkS (S:)
    gysfqnfdpkrmarasardlrispklavevcrelrgmmlndalrylddvialkrpvplkr
    yndsqghkpgkgfgpgrypvkvakaikkvllnvknnavqkgldpdklkiihiaahkgpvl
    rgwyprafgratpfneqtthievvveeirr
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records:
    >1vvkT (T:)
    pykviirpvvtekaisliekenkltfivdrratkqdikraveeifnvkvekvntlitprg
    ekkayvklkpeysasevaarlglf
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >1vvkU (U:)
    mkisskqprkqrkflynaplhvrqklmsaplsrelrekykvrnlpvrvgdkvrimrgdyk
    ghegkvvevdlkryriyvegatlrktngtevfypihpsnvmiielnledekrkkiierra
    g
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >1vvkW (W:)
    mkpseiremsieeidakirelrlqlakerglltmgtslenpmvirnlrrdiarlltikke
    klrerekgkvkk
    

    Sequence, based on observed residues (ATOM records):
    >1vvkW (W:)
    mkpseiremsieeidakirelrlqlakerglltmgtslenpmvirnlrrdiarlltikke
    klrere
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1vvkX (X:)
    mkklipilekipevelpvkeitfkeklkwtgivlvlyfimgcidvytagaqipaifefwq
    titasrigtlitlgigpivtagiimqllvgsgiiqmdlsipenralfqgcqkllsiimcf
    veavlfvgagafgiltpllaflviiqiafgsiiliyldeivskygigsgiglfiaagvsq
    tifvgalgpegylwkflnsliqgvpnieyiapiigtiivflmvvyaecmrveiplahgri
    kgavgkypikfvyvsnipvilaaalfaniqlwglalyrmgipilghyeggravdgiayyl
    stpyglssvisdpihaivymiamiitcvmfgifwvettgldpksmakrigslgmaikgfr
    ksekaiehrlkryippltvmssafvgflatianfigalgggtgvlltvsivyrmyeqllr
    ekvselhpaiakllnk
    

    Sequence, based on observed residues (ATOM records):
    >1vvkX (X:)
    kklipilekipevelpvkeitfkeklkwtgivlvlyfimgcidvytagaqipaifefwqt
    itasrigtlitlgigpivtagiimqllvgsgiiqmdlsipenralfqgcqkllsiimcfv
    eavlfvgagafgiltpllaflviiqiafgsiiliyldeivskygigsgiglfiaagvsqt
    ifvgalgpegylwkflnsliqgvpnieyiapiigtiivflmvvyaecmrveiplahgrik
    gavgkypikfvyvsnipvilaaalfaniqlwglalyrmgipilghyeggravdgiayyls
    tpyglssvisdpihaivymiamiitcvmfgifwvettgldpksmakrigslgmaikgfrk
    sekaiehrlkryippltvmssafvgflatianfigalgggtgvlltvsivyrmyeqllre
    kvselhpaiakl
    

  • Chain 'f':
    Sequence; same for both SEQRES and ATOM records:
    >1vvkf (f:)
    marnkplakklrlakalkqnrrvpvwvivktnrrvlthpkrrywrrtklke