PDB entry 1vvi

View 1vvi on RCSB PDB site
Description: Atomic-level structure of the entire HIV-1 capsid (186 hexamers + 12 pentamers)
Deposited on 2013-05-06, released 2013-05-29
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'B':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'C':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'D':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'E':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'F':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'G':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'H':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'I':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'J':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'K':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'L':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'M':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'N':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'O':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'P':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'Q':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'R':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'S':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'T':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'U':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1vviA (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1vviB (B:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1vviC (C:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1vviD (D:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1vviE (E:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >1vviF (F:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >1vviG (G:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1vviH (H:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1vviI (I:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >1vviJ (J:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >1vviK (K:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >1vviL (L:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >1vviM (M:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >1vviN (N:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >1vviO (O:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >1vviP (P:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >1vviQ (Q:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records:
    >1vviR (R:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records:
    >1vviS (S:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records:
    >1vviT (T:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >1vviU (U:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl