PDB entry 1vvg

View 1vvg on RCSB PDB site
Description: Atomic-level structure of the entire HIV-1 capsid (186 hexamers + 12 pentamers)
Deposited on 2013-05-06, released 2013-05-29
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain '1':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain '2':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'A':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'B':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'C':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'D':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'E':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'F':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'G':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'H':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'I':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'J':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'K':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'L':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'M':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'N':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'O':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'P':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'Q':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'R':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'S':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'T':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'U':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'V':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'W':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'X':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'Y':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'Z':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'a':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'b':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'c':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'd':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'e':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'f':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'g':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'h':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'i':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'j':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'k':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'l':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'm':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'n':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'o':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'p':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'q':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'r':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 's':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 't':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'u':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'v':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'w':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'x':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'y':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'z':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '0':
    Sequence; same for both SEQRES and ATOM records:
    >1vvg0 (0:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records:
    >1vvg1 (1:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records:
    >1vvg2 (2:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgA (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgB (B:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgC (C:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgD (D:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgE (E:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgF (F:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgG (G:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgH (H:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgI (I:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgJ (J:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgK (K:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgL (L:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgM (M:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgN (N:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgO (O:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgP (P:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgQ (Q:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgR (R:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgS (S:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgT (T:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgU (U:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgV (V:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgW (W:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgX (X:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgY (Y:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgZ (Z:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'a':
    Sequence; same for both SEQRES and ATOM records:
    >1vvga (a:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgb (b:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'c':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgc (c:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'd':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgd (d:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'e':
    Sequence; same for both SEQRES and ATOM records:
    >1vvge (e:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'f':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgf (f:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'g':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgg (g:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'h':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgh (h:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'i':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgi (i:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'j':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgj (j:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'k':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgk (k:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'l':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgl (l:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'm':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgm (m:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'n':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgn (n:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'o':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgo (o:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'p':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgp (p:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'q':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgq (q:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'r':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgr (r:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 's':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgs (s:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 't':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgt (t:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'u':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgu (u:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'v':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgv (v:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'w':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgw (w:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'x':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgx (x:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'y':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgy (y:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'z':
    Sequence; same for both SEQRES and ATOM records:
    >1vvgz (z:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl