PDB entry 1vve

View 1vve on RCSB PDB site
Description: c-terminal half of vaccinia virus complement control protein, nmr, 21 structures
Class: complement inhibitor
Keywords: complement inhibitor, complement module, scr, sushi domain, module pair
Deposited on 1997-06-25, released 1997-12-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vaccinia virus complement control protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: C21L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vvea1, d1vvea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vveA (A:)
vkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpptcqivk
cphptisngylssgfkrsysyndnvdfkckygyklsgsssstcspgntwkpelpkcvr