PDB entry 1vv5

View 1vv5 on RCSB PDB site
Description: Atomic-level structure of the entire HIV-1 capsid (186 hexamers + 12 pentamers)
Deposited on 2013-05-06, released 2013-05-29
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain '1':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain '2':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'A':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'B':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'C':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'D':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'E':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'F':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'G':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'H':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'I':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'J':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'K':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'L':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'M':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'N':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'O':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'P':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'Q':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'R':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'S':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'T':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'U':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'V':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'W':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'X':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'Y':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'Z':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'a':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'b':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'c':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'd':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'e':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'f':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'g':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'h':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'i':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'j':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'k':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'l':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'm':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'n':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'o':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'p':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'q':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'r':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 's':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 't':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'u':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'v':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'w':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'x':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'y':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'z':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '0':
    Sequence; same for both SEQRES and ATOM records:
    >1vv50 (0:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records:
    >1vv51 (1:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records:
    >1vv52 (2:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5A (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5B (B:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5C (C:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5D (D:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5E (E:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5F (F:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5G (G:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5H (H:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5I (I:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5J (J:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5K (K:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5L (L:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5M (M:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5N (N:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5O (O:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5P (P:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5Q (Q:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5R (R:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5S (S:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5T (T:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5U (U:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5V (V:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5W (W:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5X (X:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5Y (Y:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5Z (Z:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'a':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5a (a:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5b (b:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'c':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5c (c:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'd':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5d (d:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'e':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5e (e:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'f':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5f (f:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'g':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5g (g:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'h':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5h (h:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'i':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5i (i:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'j':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5j (j:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'k':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5k (k:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'l':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5l (l:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'm':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5m (m:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'n':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5n (n:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'o':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5o (o:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'p':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5p (p:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'q':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5q (q:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'r':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5r (r:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 's':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5s (s:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 't':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5t (t:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'u':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5u (u:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'v':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5v (v:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'w':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5w (w:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'x':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5x (x:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'y':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5y (y:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'z':
    Sequence; same for both SEQRES and ATOM records:
    >1vv5z (z:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl