PDB entry 1vuu

View 1vuu on RCSB PDB site
Description: Atomic-level structure of the entire HIV-1 capsid (186 hexamers + 12 pentamers)
Deposited on 2013-05-06, released 2013-05-29
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain '1':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain '2':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'A':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'B':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'C':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'D':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'E':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'F':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'G':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'H':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'I':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'J':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'K':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'L':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'M':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'N':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'O':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'P':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'Q':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'R':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'S':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'T':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'U':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'V':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'W':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'X':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'Y':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'Z':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'a':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'b':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'c':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'd':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'e':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'f':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'g':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'h':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'i':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'j':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'k':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'l':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'm':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'n':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'o':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'p':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'q':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'r':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 's':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 't':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'u':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'v':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'w':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'x':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'y':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)
  • Chain 'z':
    Compound: capsid protein
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79791 (0-230)
      • engineered mutation (91)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '0':
    Sequence; same for both SEQRES and ATOM records:
    >1vuu0 (0:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records:
    >1vuu1 (1:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records:
    >1vuu2 (2:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuA (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuB (B:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuC (C:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuD (D:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuE (E:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuF (F:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuG (G:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuH (H:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuI (I:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuJ (J:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuK (K:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuL (L:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuM (M:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuN (N:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuO (O:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuP (P:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuQ (Q:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuR (R:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuS (S:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuT (T:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuU (U:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuV (V:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuW (W:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuX (X:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuY (Y:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuZ (Z:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'a':
    Sequence; same for both SEQRES and ATOM records:
    >1vuua (a:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records:
    >1vuub (b:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'c':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuc (c:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'd':
    Sequence; same for both SEQRES and ATOM records:
    >1vuud (d:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'e':
    Sequence; same for both SEQRES and ATOM records:
    >1vuue (e:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'f':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuf (f:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'g':
    Sequence; same for both SEQRES and ATOM records:
    >1vuug (g:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'h':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuh (h:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'i':
    Sequence; same for both SEQRES and ATOM records:
    >1vuui (i:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'j':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuj (j:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'k':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuk (k:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'l':
    Sequence; same for both SEQRES and ATOM records:
    >1vuul (l:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'm':
    Sequence; same for both SEQRES and ATOM records:
    >1vuum (m:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'n':
    Sequence; same for both SEQRES and ATOM records:
    >1vuun (n:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'o':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuo (o:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'p':
    Sequence; same for both SEQRES and ATOM records:
    >1vuup (p:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'q':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuq (q:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'r':
    Sequence; same for both SEQRES and ATOM records:
    >1vuur (r:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 's':
    Sequence; same for both SEQRES and ATOM records:
    >1vuus (s:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 't':
    Sequence; same for both SEQRES and ATOM records:
    >1vuut (t:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'u':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuu (u:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'v':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuv (v:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'w':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuw (w:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'x':
    Sequence; same for both SEQRES and ATOM records:
    >1vuux (x:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'y':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuy (y:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

  • Chain 'z':
    Sequence; same for both SEQRES and ATOM records:
    >1vuuz (z:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl