PDB entry 1vub

View 1vub on RCSB PDB site
Description: ccdb, a topoisomerase poison from e. coli
Deposited on 1998-04-17, released 1998-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-15, with a file datestamp of 1998-07-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1vuba_
  • Chain 'B':
    Domains in SCOP 1.55: d1vubb_
  • Chain 'C':
    Domains in SCOP 1.55: d1vubc_
  • Chain 'D':
    Domains in SCOP 1.55: d1vubd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vubA (A:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vubA (A:)
    mqfkvytyrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdeswrmmtt
    dmasvpvsvigeevadlshrendiknainlmfwgi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vubB (B:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vubC (C:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vubD (D:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vubD (D:)
    mqfkvytykyrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdeswrmm
    ttdmasvpvsvigeevadlshrendiknainlmfwgi