PDB entry 1vub

View 1vub on RCSB PDB site
Description: ccdb, a topoisomerase poison from e. coli
Class: plasmid
Keywords: plasmid, ccdb, topoisomerase poison, plasmid addiction
Deposited on 1998-04-17, released 1998-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.199
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ccdb
    Species: Escherichia coli [TaxId:562]
    Gene: CCDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vuba_
  • Chain 'B':
    Compound: ccdb
    Species: Escherichia coli [TaxId:562]
    Gene: CCDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vubb_
  • Chain 'C':
    Compound: ccdb
    Species: Escherichia coli [TaxId:562]
    Gene: CCDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vubc_
  • Chain 'D':
    Compound: ccdb
    Species: Escherichia coli [TaxId:562]
    Gene: CCDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vubd_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vubA (A:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vubA (A:)
    mqfkvytyrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdeswrmmtt
    dmasvpvsvigeevadlshrendiknainlmfwgi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vubB (B:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vubC (C:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vubD (D:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vubD (D:)
    mqfkvytykyrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdeswrmm
    ttdmasvpvsvigeevadlshrendiknainlmfwgi