PDB entry 1vu1

View 1vu1 on RCSB PDB site
Description: Structure-function Analysis of Receptor-binding in Adeno-Associated Virus Serotype 6 (AAV-6)
Class: virus
Keywords: beta barrel, VIRUS
Deposited on 2011-09-13, released 2011-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.251
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu10_
  • Chain '1':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu11_
  • Chain '2':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu12_
  • Chain '3':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu13_
  • Chain '4':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu14_
  • Chain '5':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu15_
  • Chain '6':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu16_
  • Chain '7':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu17_
  • Chain 'o':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1o_
  • Chain 'p':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1p_
  • Chain 'q':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1q_
  • Chain 'r':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1r_
  • Chain 's':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1s_
  • Chain 't':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1t_
  • Chain 'u':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1u_
  • Chain 'v':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1v_
  • Chain 'w':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1w_
  • Chain 'x':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1x_
  • Chain 'y':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1y_
  • Chain 'z':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu1z_

PDB Chain Sequences:

  • Chain '0':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu10 (0:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu11 (1:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu12 (2:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu13 (3:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu14 (4:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain '5':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu15 (5:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain '6':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu16 (6:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain '7':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu17 (7:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'o':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1o (o:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'p':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1p (p:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1q (q:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'r':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1r (r:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 's':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1s (s:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 't':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1t (t:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'u':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1u (u:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'v':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1v (v:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'w':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1w (w:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'x':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1x (x:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1y (y:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu1z (z:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl