PDB entry 1vu0

View 1vu0 on RCSB PDB site
Description: Structure-function Analysis of Receptor-binding in Adeno-Associated Virus Serotype 6 (AAV-6)
Class: virus
Keywords: beta barrel, VIRUS
Deposited on 2011-09-13, released 2011-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.251
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0u_
  • Chain 'V':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0v_
  • Chain 'W':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0w_
  • Chain 'X':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0x_
  • Chain 'Y':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0y_
  • Chain 'Z':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0z_
  • Chain 'a':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0a_
  • Chain 'b':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0b_
  • Chain 'c':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0c_
  • Chain 'd':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0d_
  • Chain 'e':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0e_
  • Chain 'f':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0f_
  • Chain 'g':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0g_
  • Chain 'h':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0h_
  • Chain 'i':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0i_
  • Chain 'j':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0j_
  • Chain 'k':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0k_
  • Chain 'l':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0l_
  • Chain 'm':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0m_
  • Chain 'n':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vu0n_

PDB Chain Sequences:

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0U (U:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0V (V:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0W (W:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0X (X:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0Y (Y:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0Z (Z:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'a':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0a (a:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0b (b:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'c':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0c (c:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'd':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0d (d:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'e':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0e (e:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'f':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0f (f:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'g':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0g (g:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'h':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0h (h:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'i':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0i (i:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'j':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0j (j:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'k':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0k (k:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'l':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0l (l:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'm':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0m (m:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'n':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vu0n (n:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl