PDB entry 1vtz

View 1vtz on RCSB PDB site
Description: 1.45 Angstrom Structure of STNV coat protein (half of the capsid, the other half in PDB 3RQV)
Class: virus
Keywords: jelly-roll beta-sandwich, virus, coat protein
Deposited on 2011-04-28, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.176
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtz0_
  • Chain '1':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtz1_
  • Chain '2':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtz2_
  • Chain '3':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtz3_
  • Chain '4':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtz4_
  • Chain '5':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtz5_
  • Chain '6':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtz6_
  • Chain '7':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtz7_
  • Chain 'e':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtze_
  • Chain 'f':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzf_
  • Chain 'g':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzg_
  • Chain 'h':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzh_
  • Chain 'i':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzi_
  • Chain 'j':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzj_
  • Chain 'k':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzk_
  • Chain 'l':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzl_
  • Chain 'm':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzm_
  • Chain 'n':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzn_
  • Chain 'o':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzo_
  • Chain 'p':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzp_
  • Chain 'q':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzq_
  • Chain 'r':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzr_
  • Chain 's':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzs_
  • Chain 't':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzt_
  • Chain 'u':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzu_
  • Chain 'v':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzv_
  • Chain 'w':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzw_
  • Chain 'x':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzx_
  • Chain 'y':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzy_
  • Chain 'z':
    Compound: coat protein
    Species: Tobacco necrosis satellite virus 1 [TaxId:12445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtzz_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >1vtz0 (0:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtz0 (0:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1vtz1 (1:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtz1 (1:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1vtz2 (2:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtz2 (2:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1vtz3 (3:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtz3 (3:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1vtz4 (4:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtz4 (4:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >1vtz5 (5:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtz5 (5:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >1vtz6 (6:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtz6 (6:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >1vtz7 (7:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtz7 (7:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'e':
    Sequence, based on SEQRES records: (download)
    >1vtze (e:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtze (e:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'f':
    Sequence, based on SEQRES records: (download)
    >1vtzf (f:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzf (f:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'g':
    Sequence, based on SEQRES records: (download)
    >1vtzg (g:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzg (g:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'h':
    Sequence, based on SEQRES records: (download)
    >1vtzh (h:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzh (h:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'i':
    Sequence, based on SEQRES records: (download)
    >1vtzi (i:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzi (i:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'j':
    Sequence, based on SEQRES records: (download)
    >1vtzj (j:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzj (j:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'k':
    Sequence, based on SEQRES records: (download)
    >1vtzk (k:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzk (k:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'l':
    Sequence, based on SEQRES records: (download)
    >1vtzl (l:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzl (l:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'm':
    Sequence, based on SEQRES records: (download)
    >1vtzm (m:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzm (m:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'n':
    Sequence, based on SEQRES records: (download)
    >1vtzn (n:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzn (n:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'o':
    Sequence, based on SEQRES records: (download)
    >1vtzo (o:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzo (o:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'p':
    Sequence, based on SEQRES records: (download)
    >1vtzp (p:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzp (p:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'q':
    Sequence, based on SEQRES records: (download)
    >1vtzq (q:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzq (q:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'r':
    Sequence, based on SEQRES records: (download)
    >1vtzr (r:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzr (r:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 's':
    Sequence, based on SEQRES records: (download)
    >1vtzs (s:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzs (s:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 't':
    Sequence, based on SEQRES records: (download)
    >1vtzt (t:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzt (t:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'u':
    Sequence, based on SEQRES records: (download)
    >1vtzu (u:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzu (u:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'v':
    Sequence, based on SEQRES records: (download)
    >1vtzv (v:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzv (v:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'w':
    Sequence, based on SEQRES records: (download)
    >1vtzw (w:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzw (w:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'x':
    Sequence, based on SEQRES records: (download)
    >1vtzx (x:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzx (x:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'y':
    Sequence, based on SEQRES records: (download)
    >1vtzy (y:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzy (y:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda
    

  • Chain 'z':
    Sequence, based on SEQRES records: (download)
    >1vtzz (z:)
    makqqnnrrksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinq
    rsgdqvrivshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpit
    lqqkrftilkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigds
    lvglwdssyeavytda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtzz (z:)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda