PDB entry 1vtx

View 1vtx on RCSB PDB site
Description: delta-atracotoxin-hv1 (versutoxin) from hadronyche versuta, nmr, 20 structures
Class: neurotoxin
Keywords: neurotoxin, sodium channel toxin, cysteine knot, venom
Deposited on 1997-03-13, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-atracotoxin-hv1
    Species: Hadronyche versuta [TaxId:6904]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vtxA (A:)
    cakkrnwcgktedcccpmkcvyawyneqgscqstisalwkkc