PDB entry 1vto

View 1vto on RCSB PDB site
Description: 1.9 a resolution refined structure of tbp recognizing the minor groove of tataaaag
Class: transcription/DNA
Keywords: PROTEIN-DNA COMPLEX, DOUBLE HELIX, KINKED, TRANSCRIPTION-DNA complex
Deposited on 1996-09-06, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tata binding protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtoa1, d1vtoa2
  • Chain 'B':
    Compound: tata binding protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtob1, d1vtob2
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*gp*gp*cp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*cp*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*c)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*gp*gp*cp*a)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*tp*gp*cp*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vtoA (A:)
    pvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktt
    alifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirl
    eglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniyp
    vlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtoA (A:)
    vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta
    lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirle
    glayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypv
    lsefrki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vtoB (B:)
    pvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktt
    alifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirl
    eglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniyp
    vlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtoB (B:)
    pvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktt
    alifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirl
    eglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniyp
    vlsefrki
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.