PDB entry 1vtn

View 1vtn on RCSB PDB site
Description: co-crystal structure of the hnf-3/fork head DNA-recognition motif resembles histone h5
Class: transcription/DNA
Keywords: PROTEIN-DNA COMPLEX, DOUBLE HELIX, TRANSCRIPTION-DNA complex
Deposited on 1995-01-06, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*gp*ap*cp*tp*ap*ap*gp*tp*cp*ap*ap*cp*c)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*gp*gp*tp*tp*gp*ap*cp*tp*tp*ap*gp*tp*c)-3')
  • Chain 'C':
    Compound: hnf-3/fork head DNA-recognition motif
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtnc_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vtnC (C:)
    hakppysyislitmaiqqapgkmltlseiyqwimdlfpyyrenqqrwqnsirhslsfndc
    fvkvarspdkpgkgsywalhpssgnmfengcylrrqkrfkla