PDB entry 1vtm

View 1vtm on RCSB PDB site
Description: structure of the u2 strain of tobacco mosaic virus refined at 3.5 angstroms resolution using x-ray fiber diffraction
Class: Virus/RNA
Keywords: VIRUS, Helical virus, Virus-RNA COMPLEX
Deposited on 1992-03-30, released 1994-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: FIBER
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'P':
  Compound: coat protein
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03579 (0-157)
    • conflict (21)
    • conflict (54)
    • conflict (56)
    • conflict (96)
  Domains in SCOPe 2.08: d1vtmp_
• Chain 'R':
  Compound: RNA (5'-r(p*gp*ap*a)-3')
  Species: Tobacco mild green mosaic virus (TMGMV) [TaxId:12241]
  Gene: CP
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'P':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vtmP (P:)
  pytinspsqfvylssayadpvelinlctnalgnqfqtqqarttvqqqfadawkpspvmtv
  rfpasdfyvyrynstldplitallnsfdtrnriievnnqpapntteivnatqrvddatva
  irasinnlanelvrgtgmfnqagfetasglvwtttpat
  

  
  
• Chain 'R':
  No sequence available.