PDB entry 1vtl

View 1vtl on RCSB PDB site
Description: co-crystal structure of tbp recognizing the minor groove of a tata element
Class: transcription/DNA
Keywords: PROTEIN-DNA COMPLEX, DOUBLE HELIX, TRANSCRIPTION-DNA complex
Deposited on 1993-12-17, released 2011-07-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.202
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*gp*gp*cp*a)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*tp*gp*cp*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*gp*gp*cp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*cp*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*c)-3')
  • Chain 'E':
    Compound: tata binding protein (tbp)
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1vtle1, d1vtle2
  • Chain 'F':
    Compound: tata binding protein (tbp)
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1vtlf1, d1vtlf2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vtlE (E:)
    dlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepkttal
    ifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirleg
    layshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypvl
    sefrki
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vtlF (F:)
    dlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepkttal
    ifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirleg
    layshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypvl
    sefrki