PDB entry 1vtk

View 1vtk on RCSB PDB site
Description: thymidine kinase from herpes simplex virus type 1 in complex with ADP and deoxythymidine-monophosphate
Class: transferase
Keywords: key enzyme in thymidine salvage pathway, additional thymidylate kinase activity, target for anti-herpes viral drugs, transferase
Deposited on 1997-04-01, released 1997-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.182
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: Herpes simplex virus (type 1 / strain F) [TaxId:10304]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vtka_
  • Heterogens: ADP, TMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vtkA (A:)
    qqeatevrpeqkmptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlga
    setianiyttqhrldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshap
    ppaltlifdrhpiaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrh
    idrlakrqrpgerldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgae
    pqsnagprphigdtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqsp
    agcrdallqltsgmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vtkA (A:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagspppaltlifdrhpiaa
    llcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerld
    lamlaairrvygllantvrylqcggswredwgqlsgprphigdtlftlfrapellapngd
    lynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticd
    lartfaremgean