PDB entry 1vt4

View 1vt4 on RCSB PDB site
Description: Structure of the Drosophila apoptosome
Deposited on 2010-11-09, released 2011-01-19
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: 6.9 Å
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: Apaf-1 related killer DARK
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Ark, Hac1, dapaf-1L, CG6829, Dmel_CG6829
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KLI1 (6-588)
    • PDB 1VT4 (589-1220)
  • Chain 'J':
    Compound: Apaf-1 related killer DARK
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Ark, Hac1, dapaf-1L, CG6829, Dmel_CG6829
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KLI1 (6-588)
    • PDB 1VT4 (589-1220)
  • Chain 'K':
    Compound: Apaf-1 related killer DARK
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Ark, Hac1, dapaf-1L, CG6829, Dmel_CG6829
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KLI1 (6-588)
    • PDB 1VT4 (589-1220)
  • Chain 'L':
    Compound: Apaf-1 related killer DARK
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Ark, Hac1, dapaf-1L, CG6829, Dmel_CG6829
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KLI1 (6-588)
    • PDB 1VT4 (589-1220)
  • Chain 'M':
    Compound: Apaf-1 related killer DARK
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Ark, Hac1, dapaf-1L, CG6829, Dmel_CG6829
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KLI1 (6-588)
    • PDB 1VT4 (589-1220)
  • Chain 'N':
    Compound: Apaf-1 related killer DARK
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Ark, Hac1, dapaf-1L, CG6829, Dmel_CG6829
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KLI1 (6-588)
    • PDB 1VT4 (589-1220)
  • Chain 'O':
    Compound: Apaf-1 related killer DARK
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Ark, Hac1, dapaf-1L, CG6829, Dmel_CG6829
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KLI1 (6-588)
    • PDB 1VT4 (589-1220)
  • Chain 'P':
    Compound: Apaf-1 related killer DARK
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Ark, Hac1, dapaf-1L, CG6829, Dmel_CG6829
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KLI1 (6-588)
    • PDB 1VT4 (589-1220)
  • Heterogens: MG, DTP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1vt4I (I:)
    hhhhhhmdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskda
    vsgtlrlfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrly
    ndnqvfakynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckm
    dfkifwlnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllks
    kpyencllvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltp
    devkslllkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiie
    sslnvlepaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekq
    pkestisipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighh
    lkniehpermtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpk
    yerlvnaildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vt4I (I:)
    mdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskdavsgtlr
    lfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrlyndnqvf
    akynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckmdfkifw
    lnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllkskpyenc
    llvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltpdevksl
    llkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiiesslnvl
    epaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekqpkesti
    sipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighhlknieh
    permtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpkyerlvn
    aildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxx
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1vt4J (J:)
    hhhhhhmdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskda
    vsgtlrlfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrly
    ndnqvfakynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckm
    dfkifwlnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllks
    kpyencllvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltp
    devkslllkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiie
    sslnvlepaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekq
    pkestisipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighh
    lkniehpermtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpk
    yerlvnaildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vt4J (J:)
    mdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskdavsgtlr
    lfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrlyndnqvf
    akynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckmdfkifw
    lnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllkskpyenc
    llvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltpdevksl
    llkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiiesslnvl
    epaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekqpkesti
    sipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighhlknieh
    permtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpkyerlvn
    aildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxx
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1vt4K (K:)
    hhhhhhmdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskda
    vsgtlrlfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrly
    ndnqvfakynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckm
    dfkifwlnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllks
    kpyencllvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltp
    devkslllkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiie
    sslnvlepaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekq
    pkestisipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighh
    lkniehpermtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpk
    yerlvnaildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vt4K (K:)
    mdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskdavsgtlr
    lfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrlyndnqvf
    akynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckmdfkifw
    lnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllkskpyenc
    llvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltpdevksl
    llkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiiesslnvl
    epaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekqpkesti
    sipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighhlknieh
    permtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpkyerlvn
    aildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxx
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1vt4L (L:)
    hhhhhhmdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskda
    vsgtlrlfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrly
    ndnqvfakynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckm
    dfkifwlnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllks
    kpyencllvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltp
    devkslllkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiie
    sslnvlepaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekq
    pkestisipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighh
    lkniehpermtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpk
    yerlvnaildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vt4L (L:)
    mdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskdavsgtlr
    lfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrlyndnqvf
    akynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckmdfkifw
    lnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllkskpyenc
    llvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltpdevksl
    llkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiiesslnvl
    epaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekqpkesti
    sipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighhlknieh
    permtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpkyerlvn
    aildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxx
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1vt4M (M:)
    hhhhhhmdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskda
    vsgtlrlfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrly
    ndnqvfakynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckm
    dfkifwlnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllks
    kpyencllvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltp
    devkslllkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiie
    sslnvlepaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekq
    pkestisipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighh
    lkniehpermtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpk
    yerlvnaildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vt4M (M:)
    mdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskdavsgtlr
    lfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrlyndnqvf
    akynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckmdfkifw
    lnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllkskpyenc
    llvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltpdevksl
    llkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiiesslnvl
    epaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekqpkesti
    sipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighhlknieh
    permtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpkyerlvn
    aildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxx
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vt4N (N:)
    hhhhhhmdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskda
    vsgtlrlfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrly
    ndnqvfakynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckm
    dfkifwlnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllks
    kpyencllvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltp
    devkslllkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiie
    sslnvlepaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekq
    pkestisipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighh
    lkniehpermtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpk
    yerlvnaildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vt4N (N:)
    mdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskdavsgtlr
    lfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrlyndnqvf
    akynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckmdfkifw
    lnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllkskpyenc
    llvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltpdevksl
    llkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiiesslnvl
    epaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekqpkesti
    sipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighhlknieh
    permtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpkyerlvn
    aildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxx
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1vt4O (O:)
    hhhhhhmdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskda
    vsgtlrlfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrly
    ndnqvfakynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckm
    dfkifwlnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllks
    kpyencllvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltp
    devkslllkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiie
    sslnvlepaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekq
    pkestisipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighh
    lkniehpermtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpk
    yerlvnaildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vt4O (O:)
    mdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskdavsgtlr
    lfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrlyndnqvf
    akynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckmdfkifw
    lnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllkskpyenc
    llvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltpdevksl
    llkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiiesslnvl
    epaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekqpkesti
    sipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighhlknieh
    permtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpkyerlvn
    aildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxx
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1vt4P (P:)
    hhhhhhmdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskda
    vsgtlrlfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrly
    ndnqvfakynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckm
    dfkifwlnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllks
    kpyencllvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltp
    devkslllkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiie
    sslnvlepaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekq
    pkestisipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighh
    lkniehpermtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpk
    yerlvnaildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vt4P (P:)
    mdfetgehqyqykdilsvfedafvdnfdckdvqdmpksilskeeidhiimskdavsgtlr
    lfwtllskqeemvqkfveevlrinykflmspikteqrqpsmmtrmyieqrdrlyndnqvf
    akynvsrlqpylklrqallelrpaknvlidgvlgsgktwvaldvclsykvqckmdfkifw
    lnlkncnspetvlemlqkllyqidpnwtsrsdhssniklrihsiqaelrrllkskpyenc
    llvllnvqnakawnafnlsckillttrfkqvtdflsaattthisldhhsmtltpdevksl
    llkyldcrpqdlprevlttnprrlsiiaesirdglatwdnwkhvncdklttiiesslnvl
    epaeyrkmfdrlsvfppsahiptillsliwfdviksdvmvvvnklhkyslvekqpkesti
    sipsiylelkvkleneyalhrsivdhynipktfdsddlippyldqyfyshighhlknieh
    permtlfrmvfldfrfleqkirhdstawnasgsilntlqqlkfykpyicdndpkyerlvn
    aildflpkieenlicskytdllrialmaedeaifeeahkqvqrxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxx