PDB entry 1vt0

View 1vt0 on RCSB PDB site
Description: Bacteriophage P22 Portal Protein bound to middle Tail Factor GP4. This file contain the second biological assembly
Deposited on 2010-04-19, released 2011-05-04
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.222
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: portal protein
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 1, gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 'l':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 'm':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 'n':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 'o':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 'p':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 'q':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 'r':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 's':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 't':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 'u':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Chain 'v':
    Compound: Packaged DNA stabilization protein gp4
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: 4, gp4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26746
      • engineered mutation (140)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1vt0M (M:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0M (M:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vt0N (N:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0N (N:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1vt0O (O:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0O (O:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1vt0P (P:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0P (P:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1vt0Q (Q:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0Q (Q:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >1vt0R (R:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0R (R:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1vt0S (S:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0S (S:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1vt0T (T:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0T (T:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1vt0U (U:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0U (U:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >1vt0V (V:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0V (V:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >1vt0W (W:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0W (W:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1vt0X (X:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qg
    

    Sequence, based on observed residues (ATOM records):
    >1vt0X (X:)
    enrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvv
    rklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvg
    awrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngw
    edfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepv
    syfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvf
    gewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmyd
    gnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdtea
    vnggqvafdtvnqlnmradletyvfqdnlatamrrdgeimaevvdlatgekqvlndirgr
    yecytdvgpsfqsmkqqnraeilellgktpqgtpeyqllllqyftlldgkgvemmrdyan
    kqliqmgvkkpetpeeqqwlveaqqakqg
    

  • Chain 'k':
    Sequence, based on SEQRES records:
    >1vt0k (k:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0k (k:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 'l':
    Sequence, based on SEQRES records:
    >1vt0l (l:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0l (l:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 'm':
    Sequence, based on SEQRES records:
    >1vt0m (m:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0m (m:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 'n':
    Sequence, based on SEQRES records:
    >1vt0n (n:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0n (n:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 'o':
    Sequence, based on SEQRES records:
    >1vt0o (o:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0o (o:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 'p':
    Sequence, based on SEQRES records:
    >1vt0p (p:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0p (p:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 'q':
    Sequence, based on SEQRES records:
    >1vt0q (q:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0q (q:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 'r':
    Sequence, based on SEQRES records:
    >1vt0r (r:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0r (r:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 's':
    Sequence, based on SEQRES records:
    >1vt0s (s:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0s (s:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 't':
    Sequence, based on SEQRES records:
    >1vt0t (t:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0t (t:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 'u':
    Sequence, based on SEQRES records:
    >1vt0u (u:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0u (u:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp
    

  • Chain 'v':
    Sequence, based on SEQRES records:
    >1vt0v (v:)
    mqiktkgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvf
    sddenppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtai
    srakrapypsrmptgsgnsfpnlnewhyfpgeqnadsttphdegng
    

    Sequence, based on observed residues (ATOM records):
    >1vt0v (v:)
    kgdlvraalrklgvasdatltdvepqsmqdavddleammaewyqdgkgiitgyvfsdden
    ppaegddhglrssavsavfhnlacriapdyaleatakiiatakygkellykqtaisrakr
    apypsrmptgsgnsfpnlnewhyfp