PDB entry 1vsz

View 1vsz on RCSB PDB site
Description: Crystal structure of human adenovirus at 3.5A
Deposited on 2010-04-08, released 2011-01-12
The last revision was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.38
AEROSPACI score: -0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: penton protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Putative Peripentonal hexon-associated protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VSZ (3-End)
  • Chain 'Q':
    Compound: Putative Peripentonal hexon-associated protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VSZ (88-End)
  • Chain 'R':
    Compound: Hexon-associated protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Hexon-associated protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Putative Peripentonal hexon-associated protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VSZ
  • Chain 'U':
    Compound: Putative Peripentonal hexon-associated protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VSZ (0-End)
  • Chain 'V':
    Compound: Putative Peripentonal hexon-associated protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VSZ (0-End)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vszA (A:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszA (A:)
    psmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqr
    ltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtayna
    lapkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesqwy
    eteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffsttnl
    tpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyyn
    stgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvri
    ienhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfamei
    nlnanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlga
    rwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytye
    wnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtndqs
    fndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyytys
    gsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmt
    kdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhq
    hnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfmsm
    galtdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylr
    tpfsagna
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vszB (B:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszB (B:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesq
    wyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffstt
    nltpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmy
    ynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdv
    riienhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfam
    einlnanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinl
    garwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsyt
    yewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtnd
    qsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyyt
    ysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcn
    mtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgil
    hqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfm
    smgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvy
    lrtpfsa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vszC (C:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszC (C:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesq
    wyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffstt
    nltpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmy
    ynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdv
    riienhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfam
    einlnanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinl
    garwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsyt
    yewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtnd
    qsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyyt
    ysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcn
    mtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgil
    hqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfm
    smgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvy
    lrtpfsa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vszD (D:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszD (D:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesq
    wyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffstt
    nltpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmy
    ynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdv
    riienhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfam
    einlnanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinl
    garwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsyt
    yewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtnd
    qsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyyt
    ysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcn
    mtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgil
    hqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfm
    smgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvy
    lrtpfsagnatt
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vszE (E:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszE (E:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesq
    wyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffstt
    nltpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmy
    ynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdv
    riienhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfam
    einlnanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinl
    garwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsyt
    yewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtnd
    qsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyyt
    ysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcn
    mtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgil
    hqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfm
    smgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvy
    lrtpfsagnatt
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1vszF (F:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszF (F:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesq
    wyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffstt
    nltpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmy
    ynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdv
    riienhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfam
    einlnanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinl
    garwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsyt
    yewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtnd
    qsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyyt
    ysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcn
    mtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgil
    hqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfm
    smgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvy
    lrtpfsagn
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1vszG (G:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszG (G:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesq
    wyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffstt
    nltpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmy
    ynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdv
    riienhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfam
    einlnanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinl
    garwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsyt
    yewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtnd
    qsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyyt
    ysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcn
    mtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgil
    hqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfm
    smgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvy
    lrtpfsagnatt
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1vszH (H:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszH (H:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesqwyet
    einhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffsttnltp
    kvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynst
    gnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriie
    nhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfameinl
    nanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarw
    sldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewn
    frkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtndqsfn
    dylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgs
    ipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkd
    wflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhn
    nsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfmsmga
    ltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtp
    fsagn
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1vszI (I:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszI (I:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesq
    wyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffstt
    nltpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmy
    ynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdv
    riienhgtedelpnycfplggvintetltkvkwekdafsdkneirvgnnfameinlnanl
    wrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldy
    mdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkd
    vnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndyls
    aanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyl
    dgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflv
    qmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgf
    vgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdl
    gqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsag
    na
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1vszJ (J:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszJ (J:)
    smmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrl
    tlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynal
    apkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesqwye
    teinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffsttnlt
    pkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyyns
    tgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvrii
    enhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfamein
    lnanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgar
    wsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyew
    nfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtndqsf
    ndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysg
    sipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtk
    dwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqh
    nnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfmsmg
    altdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrt
    pfsag
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1vszK (K:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszK (K:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesq
    wyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffstt
    nltpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmy
    ynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdv
    riienhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfam
    einlnanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinl
    garwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsyt
    yewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtnd
    qsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyyt
    ysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcn
    mtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgil
    hqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfm
    smgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvy
    lrtpfsagnatt
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1vszL (L:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    intetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1vszL (L:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesq
    wyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqffstt
    nltpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmy
    ynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdv
    riienhgtedelpnycfplggvintetltkvkpktgqengwekdafsdkneirvgnnfam
    einlnanlwrnflysnialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinl
    garwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsyt
    yewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtnd
    qsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyyt
    ysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcn
    mtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgil
    hqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfssnfm
    smgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvy
    lrtpfs
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vszN (N:)
    mrraamyeegpppsyesvvsaapvaaalgspfdapldppfvpprylrptggrnsirysel
    aplfdttrvylvdnkstdvaslnyqndhsnflttviqnndyspgeastqtinlddrshwg
    gdlktilhtnmpnvnefmftnkfkarvmvsrlptkdnqvelkyewveftlpegnysetmt
    idlmnnaivehylkvgrqngvlesdigvkfdtrnfrlgfdpvtglvmpgvytneafhpdi
    illpgcgvdfthsrlsnllgirkrqpfqegfrityddleggnipalldvdayqaslkddt
    eqggggaggsnssgsgaeensnaaaaamqpvedmndhairgdtfatraeekraeaeaaae
    aaapaaqpevekpqkkpvikpltedskkrsynlisndstftqyrswylaynygdpqtgir
    swtllctpdvtcgseqvywslpdmmqdpvtfrstrqisnfpvvgaellpvhsksfyndqa
    vysqlirqftslthvfnrfpenqilarppaptittvsenvpaltdhgtlplrnsiggvqr
    vtitdarrrtcpyvykalgivsprvlssrtf
    

    Sequence, based on observed residues (ATOM records):
    >1vszN (N:)
    tggrnsiryselaplfdttrvylvdnkstdvaslnyqndhsnflttviqnndyspgeast
    qtinlddrshwggdlktilhtnmpnvnefmftnkfkarvmvsrlptkdnqvelkyewvef
    tlpegnysetmtidlmnnaivehylkvgrqngvlesdigvkfdtrnfrlgfdpvtglvmp
    gvytneafhpdiillpgcgvdfthsrlsnllgirkrqpfqegfrityddleggnipalld
    vdayqaslkdpqkkpvikpltedskkrsynlisndstftqyrswylaynygdpqtgirsw
    tllctpdvtcgseqvywslpdmmqdpvtfrstrqisnfpvvgaellpvhsksfyndqavy
    sqlirqftslthvfnrfpenqilarppaptittvsenvpaltdhgtlplrnsiggvqrvt
    itdarrrtcpyvykalgivsprvlssr
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >1vszP (P:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxx
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1vszQ (Q:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vszQ (Q:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >1vszR (R:)
    mskeiptpymwsyqpqmglaagaaqdystrinymsagphmisrvngirahrnrilleqaa
    itttprnnlnprswpaalvyqespapttvvlprdaqaevqmtnsgaqlaggfrhrvrspg
    qgithltirgrgiqlndesvssslglrpdgtfqiggagrpsftprqailtlqtssseprs
    ggigtlqfieefvpsvyfnpfsgppghypdqfipnfdavkdsadgyd
    

    Sequence, based on observed residues (ATOM records):
    >1vszR (R:)
    gphmisrvngirahrnrilleqaaitttprnnlnprswpaalvyqespapttvv
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1vszS (S:)
    mskeiptpymwsyqpqmglaagaaqdystrinymsagphmisrvngirahrnrilleqaa
    itttprnnlnprswpaalvyqespapttvvlprdaqaevqmtnsgaqlaggfrhrvrspg
    qgithltirgrgiqlndesvssslglrpdgtfqiggagrpsftprqailtlqtssseprs
    ggigtlqfieefvpsvyfnpfsgppghypdqfipnfdavkdsadgyd
    

    Sequence, based on observed residues (ATOM records):
    >1vszS (S:)
    gphmisrvngirahrnrilleqaaitttprnnlnprswpaalvyqespapttvv
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1vszT (T:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vszT (T:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1vszU (U:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vszU (U:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxx
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >1vszV (V:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >1vszV (V:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx