PDB entry 1vsx

View 1vsx on RCSB PDB site
Description: Crystal Structure of Lumazine Synthase from Bacillus Anthracis
Deposited on 2009-09-16, released 2010-11-10
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.236
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ribH
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence, based on SEQRES records:
    >1vsx1 (1:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsx1 (1:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >1vsx2 (2:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsx2 (2:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >1vsx3 (3:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsx3 (3:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain '4':
    Sequence, based on SEQRES records:
    >1vsx4 (4:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsx4 (4:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vsxA (A:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxA (A:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vsxB (B:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxB (B:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vsxC (C:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxC (C:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vsxD (D:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxD (D:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vsxE (E:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxE (E:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1vsxF (F:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxF (F:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1vsxG (G:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxG (G:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1vsxH (H:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxH (H:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1vsxI (I:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxI (I:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1vsxJ (J:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxJ (J:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1vsxK (K:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxK (K:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1vsxL (L:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxL (L:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1vsxM (M:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxM (M:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vsxN (N:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxN (N:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1vsxO (O:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxO (O:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1vsxP (P:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxP (P:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1vsxQ (Q:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxQ (Q:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >1vsxR (R:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxR (R:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1vsxS (S:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxS (S:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1vsxT (T:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxT (T:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1vsxU (U:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxU (U:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >1vsxV (V:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxV (V:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >1vsxW (W:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxW (W:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1vsxX (X:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxX (X:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >1vsxY (Y:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxY (Y:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >1vsxZ (Z:)
    mvfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipl
    iakkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvltteti
    eqaieragtkagnkgyesavaaiemahlskhwa
    

    Sequence, based on observed residues (ATOM records):
    >1vsxZ (Z:)
    vfeghlvgtglkvgvvvgrfnefitskllggaldglkrhgveendidvawvpgafeipli
    akkmansgkydavitlgtvirgatthydyvcnevakgvaslslqtdipvifgvlttetie
    qaieragtkagnkgyesavaaiemahlskhwa