PDB entry 1vsu

View 1vsu on RCSB PDB site
Description: Crystal Structure of Apo-glyceraldehyde 3-phosphate dehydrogenase from Cryptosporidium parvum
Deposited on 2008-03-10, released 2009-03-24
The last revision was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vsuA (A:)
    mgsshhhhhhssglvprgshmtatlgingfgrigrlvlracmernditvvaindpfmdve
    ymayllkydsvhgnfngtvevsgkdlcingkvvkvfqakdpaeipwgasgaqivcestgv
    ftteekaslhlkggakkviisappkdnvpmyvmgvnnteydpskfnvisnascttnclap
    lakiindkfgiveglmttvhsltanqltvdgpskggkdwragrcagnniipastgaakav
    gkvipalngkltgmairvptpdvsvvdltcklakpasieeiyqavkeasngpmkgimgyt
    sddvvstdfigckyssifdknacialndsfvkliswydnesgysnrlvdlavyvasrgl
    

    Sequence, based on observed residues (ATOM records):
    >1vsuA (A:)
    tatlgingfgrigrlvlracmernditvvaindpfmdveymayllkydsvhgnfngtvev
    sgkdlcingkvvkvfqakdpaeipwgasgaqivcestgvftteekaslhlkggakkviis
    appkdnvpmyvmgvnnteydpskfnvisnascttnclaplakiindkfgiveglmttvhs
    ltadwragrcagnniipastgaakavgkvipalngkltgmairvptpdvsvvdltcklak
    pasieeiyqavkeasngpmkgimgytsddvvstdfigckyssifdknacialndsfvkli
    swydnesgysnrlvdlavyvasrgl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vsuB (B:)
    mgsshhhhhhssglvprgshmtatlgingfgrigrlvlracmernditvvaindpfmdve
    ymayllkydsvhgnfngtvevsgkdlcingkvvkvfqakdpaeipwgasgaqivcestgv
    ftteekaslhlkggakkviisappkdnvpmyvmgvnnteydpskfnvisnascttnclap
    lakiindkfgiveglmttvhsltanqltvdgpskggkdwragrcagnniipastgaakav
    gkvipalngkltgmairvptpdvsvvdltcklakpasieeiyqavkeasngpmkgimgyt
    sddvvstdfigckyssifdknacialndsfvkliswydnesgysnrlvdlavyvasrgl
    

    Sequence, based on observed residues (ATOM records):
    >1vsuB (B:)
    tatlgingfgrigrlvlracmernditvvaindpfmdveymayllkydsvhgnfngtvev
    sgkdlcingkvvkvfqakdpaeipwgasgaqivcestgvftteekaslhlkggakkviis
    appkdnvpmyvmgvnnteydpskfnvisnascttnclaplakiindkfgiveglmttvhs
    ltadwragrcagnniipastgaakavgkvipalngkltgmairvptpdvsvvdltcklak
    pasieeiyqavkeasngpmkgimgytsddvvstdfigckyssifdknacialndsfvkli
    swydnesgysnrlvdlavyvasrgl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vsuC (C:)
    mgsshhhhhhssglvprgshmtatlgingfgrigrlvlracmernditvvaindpfmdve
    ymayllkydsvhgnfngtvevsgkdlcingkvvkvfqakdpaeipwgasgaqivcestgv
    ftteekaslhlkggakkviisappkdnvpmyvmgvnnteydpskfnvisnascttnclap
    lakiindkfgiveglmttvhsltanqltvdgpskggkdwragrcagnniipastgaakav
    gkvipalngkltgmairvptpdvsvvdltcklakpasieeiyqavkeasngpmkgimgyt
    sddvvstdfigckyssifdknacialndsfvkliswydnesgysnrlvdlavyvasrgl
    

    Sequence, based on observed residues (ATOM records):
    >1vsuC (C:)
    tatlgingfgrigrlvlracmernditvvaindpfmdveymayllkydsvhgnfngtvev
    sgkdlcingkvvkvfqakdpaeipwgasgaqivcestgvftteekaslhlkggakkviis
    appkdnvpmyvmgvnnteydpskfnvisnascttnclaplakiindkfgiveglmttvhs
    ltadwragrcagnniipastgaakavgkvipalngkltgmairvptpdvsvvdltcklak
    pasieeiyqavkeasngpmkgimgytsddvvstdfigckyssifdknacialndsfvkli
    swydnesgysnrlvdlavyvasrgl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vsuD (D:)
    mgsshhhhhhssglvprgshmtatlgingfgrigrlvlracmernditvvaindpfmdve
    ymayllkydsvhgnfngtvevsgkdlcingkvvkvfqakdpaeipwgasgaqivcestgv
    ftteekaslhlkggakkviisappkdnvpmyvmgvnnteydpskfnvisnascttnclap
    lakiindkfgiveglmttvhsltanqltvdgpskggkdwragrcagnniipastgaakav
    gkvipalngkltgmairvptpdvsvvdltcklakpasieeiyqavkeasngpmkgimgyt
    sddvvstdfigckyssifdknacialndsfvkliswydnesgysnrlvdlavyvasrgl
    

    Sequence, based on observed residues (ATOM records):
    >1vsuD (D:)
    tatlgingfgrigrlvlracmernditvvaindpfmdveymayllkydsvhgnfngtvev
    sgkdlcingkvvkvfqakdpaeipwgasgaqivcestgvftteekaslhlkggakkviis
    appkdnvpmyvmgvnnteydpskfnvisnascttnclaplakiindkfgiveglmttvhs
    ltadwragrcagnniipastgaakavgkvipalngkltgmairvptpdvsvvdltcklak
    pasieeiyqavkeasngpmkgimgytsddvvstdfigckyssifdknacialndsfvkli
    swydnesgysnrlvdlavyvasrgl