PDB entry 1vst

View 1vst on RCSB PDB site
Description: Symmetric Sulfolobus solfataricus uracil phosphoribosyltransferase with bound PRPP and GTP
Class: transferase
Keywords: uracil, phosphoribosyltransferase, allosteric regulation, Sulfolobus solfataricus, PRPP, GTP, Glycosyltransferase, Magnesium, Transferase
Deposited on 2009-02-09, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SSO0231, upp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vsta_
  • Heterogens: GTP, MG, PRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vstA (A:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vstA (A:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg