PDB entry 1vsr

View 1vsr on RCSB PDB site
Description: very short patch repair (vsr) endonuclease from escherichia coli
Class: hydrolase
Keywords: endonuclease, DNA repair, mismatch recognition, hydrolase
Deposited on 1999-02-13, released 1999-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (vsr endonuclease)
    Species: Escherichia coli [TaxId:83333]
    Gene: VSR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vsra_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vsrA (A:)
    dtaiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvifthgcfwhhhhcylfkvpa
    trtefwlekigknverdrrdisrlqelgwrvlivwecalrgrekltdealterleewicg
    egasaqidtqgihlla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsrA (A:)
    aiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvifthgcfwhhhhcylfkvpatr
    tefwlekigknverdrrdisrlqelgwrvlivwecalrgrekltdealterleewicgeg
    asaqidtqgihlla