PDB entry 1vsp

View 1vsp on RCSB PDB site
Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH
Class: ribosome
Keywords: 70S ribosome, Shine-Dalgarno
Deposited on 2007-07-18, released 2007-11-13
The last revision prior to the SCOP 1.75 freeze date was dated 2007-11-13, with a file datestamp of 2007-11-09.
Experiment type: XRAY
Resolution: 3.83 Å
R-factor: 0.327
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vspa1
  • Chain 'B':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vspc1
  • Chain 'D':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vspf1, d1vspf2
  • Chain 'G':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72IN1 (0-End)
      • conflict (0)
  • Chain 'I':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vspi1
  • Chain 'J':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vspj1
  • Chain 'K':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vspo1
  • Chain 'P':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vspp1
  • Chain 'Q':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 50S ribosomal protein L24
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vsps1
  • Chain 'T':
    Compound: 50S ribosomal protein L25
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vspt1
  • Chain 'U':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: LSU ribosomal protein L28P
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: LSU ribosomal protein L30P
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vspz1
  • Chain 'a':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: 50S ribosomal protein L36
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'w':
    Compound: 23s large subunit ribosomal RNA
    Species: Thermus thermophilus
  • Chain 'x':
    Compound: 5s large subunit ribosomal RNA
    Species: Thermus thermophilus

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vspA (A:)
    mpkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvr
    gtvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdv
    mgavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkas
    fppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vspA (A:)
    kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsi
    efrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvyvtttmgps
    vrinphs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vspC (C:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vspC (C:)
    gilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvnrp
    lkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrwnf
    aggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeenll
    lvkgavpgpngglvivretkk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vspF (F:)
    msrigrlpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderr
    hkslhgltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppeg
    itfevpeptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vspF (F:)
    lpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderrhkslhg
    ltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppegitfevp
    eptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagak
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vspI (I:)
    miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
    vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
    vl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1vspJ (J:)
    mklsdlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlm
    rlpkrgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegea
    kplkvvahafsksaleklkaaggepvllea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vspJ (J:)
    dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
    rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
    vvahafsksaleklkaaggepvllea
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1vspO (O:)
    mpraktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrl
    wivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vspO (O:)
    praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
    ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vspP (P:)
    mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
    vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1vspS (S:)
    mrvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggf
    iekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcggaldtee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vspS (S:)
    mrvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggf
    iekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1vspT (T:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklaeeaaaevaepevikkgkeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vspT (T:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklae
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1vspZ (Z:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vspZ (Z:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'w':
    No sequence available.

  • Chain 'x':
    No sequence available.