PDB entry 1vso

View 1vso on RCSB PDB site
Description: Crystal Structure of the Ligand-Binding Core of iGluR5 in Complex With the Antagonist (S)-ATPO at 1.85 A resolution
Class: membrane protein
Keywords: Antagonist complex, MEMBRANE PROTEIN
Deposited on 2007-03-29, released 2007-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor, ionotropic kainate 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grik1, Glur5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22756 (118-End)
      • see remark 999 (33)
      • linker (116-117)
    Domains in SCOPe 2.07: d1vsoa_
  • Heterogens: AT1, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vsoA (A:)
    ganrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgk
    ygaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpi
    dsaddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrv
    lttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqee
    gklhmmkekwwrgngcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsoA (A:)
    tlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkygaq
    wngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpidsaddlakq
    tkieygavrdgstmtffkkskistyekmwafmsssalvknsdegiqrvlttdyallmest
    sieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegklhmmkekwwr
    gng