PDB entry 1vsn

View 1vsn on RCSB PDB site
Description: Crystal structure of a potent small molecule inhibitor bound to cathepsin K
Class: hydrolase
Keywords: osteoporosis, structure-guided drug design, proteae, Hydrolase
Deposited on 2007-03-19, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43235 (0-214)
      • conflict (4)
      • conflict (40)
      • conflict (43)
      • conflict (48)
      • conflict (76)
      • conflict (92)
      • conflict (118)
      • conflict (126)
      • conflict (146)
      • conflict (153)
      • conflict (155)
      • conflict (158)
      • conflict (172)
      • conflict (182)
      • conflict (190)
    Domains in SCOPe 2.07: d1vsna1
  • Heterogens: NFT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vsnA (A:)
    apdsidyrkkgyvtpvknqgqcgscwafssvgalegqlkkatgallnlapqnlvdcvsen
    dgcgggymtnafqyvqrnrgidsedaypyvgqdescmynptgkaakcrgyreipegneaa
    lkravaavgpvsvaidasltsfqfysagvyydencssdalnhavlavgygiqagnkhwii
    knswgeswgnagyilmarnknnacgianlasfpkm