PDB entry 1vsm

View 1vsm on RCSB PDB site
Description: asv integrase core domain in citrate buffer ph 5.0
Class: hydrolase
Keywords: endonuclease, transferase, hydrolase
Deposited on 1998-09-18, released 1998-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.146
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (integrase)
  Species: Rous sarcoma virus (strain Schmidt-Ruppin) [TaxId:11889]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03354 (0-145)
    • see remark 999 (47)
    • see remark 999 (112)
  Domains in SCOPe 2.07: d1vsma_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vsmA (A:)
  glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
  rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
  dgfmkriptskqgellakamyalnhf