PDB entry 1vsm

View 1vsm on RCSB PDB site
Description: asv integrase core domain in citrate buffer ph 5.0
Class: hydrolase
Keywords: endonuclease, transferase, hydrolase
Deposited on 1998-09-18, released 1998-09-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.146
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (integrase)
    Species: Rous sarcoma virus (strain Schmidt-Ruppin) [TaxId:11889]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (0-145)
      • see remark 999 (47)
      • see remark 999 (112)
    Domains in SCOPe 2.04: d1vsma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vsmA (A:)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
    dgfmkriptskqgellakamyalnhf