PDB entry 1vsl

View 1vsl on RCSB PDB site
Description: asv integrase core domain d64n mutation with zinc cation
Deposited on 1998-09-18, released 1998-09-23
The last revision prior to the SCOP 1.71 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.156
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vsla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vslA (A:)
glgplqiwqtnftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf