PDB entry 1vsk

View 1vsk on RCSB PDB site
Description: asv integrase core domain d64n mutation in citrate buffer ph 6.0
Class: hydrolase
Keywords: hydrolase, endonuclease, transferase
Deposited on 1998-09-18, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.159
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Rous sarcoma virus - Schmidt-Ruppin B [TaxId:269447]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (0-145)
      • engineered (10)
      • variation (47)
      • variation (112)
    Domains in SCOPe 2.07: d1vska_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vskA (A:)
    glgplqiwqtnftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
    dgfmkriptskqgellakamyalnhf