PDB entry 1vsj

View 1vsj on RCSB PDB site
Description: asv integrase core domain with cd(ii) cofactors
Deposited on 1997-03-04, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1vsj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1vsj_ (-)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
    rpkaiktdngsxftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
    dgfmkriptskqgellakamyalnhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsj_ (-)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
    rpkaiktdngsftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaegd
    gfmkriptskqgellakamyalnhf