PDB entry 1vsh

View 1vsh on RCSB PDB site
Description: asv integrase core domain with zn(II) cofactors
Class: endonuclease
Keywords: endonuclease, hydrolase, endoribonuclease, RNA-directed DNA polymerase
Deposited on 1997-03-04, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.173
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Rous sarcoma virus (strain Schmidt-Ruppin) [TaxId:11889]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (4-149)
      • variant (51)
      • modified residue (75)
      • variant (116)
    Domains in SCOPe 2.07: d1vsha_
  • Heterogens: ZN, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vshA (A:)
    plreglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwatai
    avlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirv
    laegdgfmkriptskqgellakamyalnhfnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vshA (A:)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
    dgfmkriptskqgellakamyalnhf