PDB entry 1vse

View 1vse on RCSB PDB site
Description: asv integrase core domain with mg(II) cofactor and hepes ligand, low mg concentration form
Class: endoribonuclease
Keywords: hydrolase, endonuclease, endoribonuclease
Deposited on 1995-11-29, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.138
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Rous sarcoma virus (strain Schmidt-Ruppin) [TaxId:11889]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (4-149)
      • conflict (51)
      • conflict (116)
    Domains in SCOPe 2.07: d1vsea_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vseA (A:)
    plreglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwatai
    avlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirv
    laegdgfmkriptskqgellakamyalnhfnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vseA (A:)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
    dgfmkriptskqgellakamyalnhf