PDB entry 1vsc

View 1vsc on RCSB PDB site
Description: vcam-1
Class: cell adhesion protein
Keywords: cell adhesion protein, immunoglobulin fold, glycoprotein
Deposited on 1995-04-27, released 1996-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vascular cell adhesion molecule-1
    Species: Homo sapiens [TaxId:9606]
    Gene: VCAM-D1D2-IG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vsca1, d1vsca2
  • Chain 'B':
    Compound: vascular cell adhesion molecule-1
    Species: Homo sapiens [TaxId:9606]
    Gene: VCAM-D1D2-IG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vscb1, d1vscb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vscA (A:)
    fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
    vsfgnehsylctatcesrklekgiqveiysfpkdpeihlsgpleagkpitvkcsvadvyp
    fdrleidllkgdhlmksqefledadrksletkslevtftpviedigkvlvcraklhidem
    dsvptvrqavkelqvd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vscB (B:)
    fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
    vsfgnehsylctatcesrklekgiqveiysfpkdpeihlsgpleagkpitvkcsvadvyp
    fdrleidllkgdhlmksqefledadrksletkslevtftpviedigkvlvcraklhidem
    dsvptvrqavkelqvd