PDB entry 1vsa

View 1vsa on RCSB PDB site
Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
Class: ribosome
Keywords: RIBOSOME, FUNCTIONAL COMPLEX, TRNA, E site, P site, PEPTIDYL TRANSFERASE CENTER
Deposited on 2007-02-15, released 2007-05-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.71 Å
R-factor: 0.349
AEROSPACI score: -0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsaa1
  • Chain 'B':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsac1
  • Chain 'D':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsaf1, d1vsaf2
  • Chain 'G':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsah1
  • Chain 'I':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsai1
  • Chain 'J':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsaj1
  • Chain 'K':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsal1
  • Chain 'M':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsam1
  • Chain 'N':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsao1
  • Chain 'P':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsap1
  • Chain 'Q':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsaq1
  • Chain 'R':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsar1
  • Chain 'S':
    Compound: 50S ribosomal protein L24
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsas1
  • Chain 'T':
    Compound: 50S ribosomal protein L25
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsat1
  • Chain 'U':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsau1
  • Chain 'V':
    Compound: 50S ribosomal protein L28
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsaw1
  • Chain 'X':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsax1
  • Chain 'Y':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsaz1
  • Chain 'a':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: 50S ribosomal protein L36
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1vsab1
  • Chain 'w':
    Compound: 23s large subunit ribosomal RNA
    Species: Thermus thermophilus [TaxId:262724]
  • Chain 'x':
    Compound: 5s large subunit ribosomal RNA
    Species: Thermus thermophilus [TaxId:262724]

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vsaA (A:)
    mpkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvr
    gtvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdv
    mgavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkas
    fppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaA (A:)
    kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsi
    efrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvyvtttmgps
    vrinphs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vsaC (C:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaC (C:)
    gilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvnrp
    lkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrwnf
    aggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeenll
    lvkgavpgpngglvivretkk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vsaF (F:)
    msrigrlpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderr
    hkslhgltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppeg
    itfevpeptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaF (F:)
    lpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderrhkslhg
    ltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppegitfevp
    eptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagak
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vsaH (H:)
    mvksslaflrgppiprqeqrralvktyvpkqveprwvlidaegktlgrlatkiatllrgk
    hrpdwtpnvamgdfvvvvnadkirvtgkkleqkiytrysgypgglkkiplekmlathper
    vlehavkgmlpkgplgrrlfkrlkvyagpdhphqaqrpeklev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaH (H:)
    vktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
    rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
    kvyagpdhphqaqrpekl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vsaI (I:)
    miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
    vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
    vl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1vsaJ (J:)
    mklsdlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlm
    rlpkrgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegea
    kplkvvahafsksaleklkaaggepvllea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaJ (J:)
    dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
    rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
    vvahafsksaleklkaaggepvllea
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vsaL (L:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1vsaM (M:)
    marltayerrkfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkg
    nktevarqvgralaekalalgikqvafdrgpykyhgrvkalaegaregglef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaM (M:)
    yerrkfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnkteva
    rqvgralaekalalgikqvafdrgpykyhgrvkalaegaregglef
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1vsaO (O:)
    mpraktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrl
    wivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaO (O:)
    praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
    ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vsaP (P:)
    mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
    vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1vsaQ (Q:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaQ (Q:)
    eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
    hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1vsaR (R:)
    mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
    gkkkrlgrylgkrpdrkkaivqvapgqkiealegli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaR (R:)
    taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk
    kkrlgrylgkrpdrkkaivqvapgqkiealeg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1vsaS (S:)
    mrvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggf
    iekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcggaldtee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaS (S:)
    mrvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggf
    iekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1vsaT (T:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklaeeaaaevaepevikkgkeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaT (T:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklae
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1vsaU (U:)
    mahkkglgstkngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlf
    alvdgvvefqdrgrlgryvhvrpla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaU (U:)
    tkngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvef
    qdrgrlgryvhvrpla
    

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1vsaW (W:)
    mklsevrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarl
    ltvlnekrrqna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaW (W:)
    mklsevrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarl
    lt
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vsaX (X:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1vsaZ (Z:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsaZ (Z:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    Sequence, based on SEQRES records: (download)
    >1vsab (b:)
    mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsab (b:)
    kvrasvkricdkckvirrhgrvyvicenpkhkqrq
    

  • Chain 'w':
    No sequence available.

  • Chain 'x':
    No sequence available.