PDB entry 1vs9

View 1vs9 on RCSB PDB site
Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VS9, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2I1C
Deposited on 2006-08-14, released 2006-09-26
The last revision was dated 2007-05-15, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.346
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72GV9 (Start-228)
      • conflict (179)
  • Chain 'B':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72I05
      • conflict (13-14)
  • Chain 'E':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72I14
      • insertion (51)
  • Chain 'J':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus
  • Chain 'P':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus
  • Chain 'Q':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 50S ribosomal protein L24
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 50S ribosomal protein L25
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: 50S ribosomal protein L28
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus
  • Chain 'Z':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus
  • Chain 'b':
    Compound: 50S ribosomal protein L36
    Species: Thermus thermophilus
  • Chain 'w':
    Compound: 23s large subunit ribosomal RNA
    Species: Thermus thermophilus
  • Chain 'x':
    Compound: 5s large subunit ribosomal RNA
    Species: Thermus thermophilus

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vs9A (A:)
    mpkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvr
    gtvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdv
    mgavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkac
    fppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

    Sequence, based on observed residues (ATOM records):
    >1vs9A (A:)
    kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsi
    efrndktgaihapvgkacfppekladnirafiraleahkpegakgtflrsvyvtttmgps
    vrinphs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vs9B (B:)
    mavkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkr
    lyriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvag
    pdapiqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsg
    elrkvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegra
    prgrppaspwgwqtkglktrkrrkpssrfiiarrkk
    

    Sequence, based on observed residues (ATOM records):
    >1vs9B (B:)
    kkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrlyr
    iidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagpda
    piqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsgelr
    kvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegraprg
    rppaspwgwqtkglktrkrrk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vs9C (C:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaak
    

    Sequence, based on observed residues (ATOM records):
    >1vs9C (C:)
    gilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvnrp
    lkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrwnf
    aggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeenll
    lvkgavpgpngglvivretkk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vs9D (D:)
    myqipvlspsgrrdvaadlpaeinphllwevvrwqlakrrrgtastktrgevaysgrkiw
    pqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadraregklll
    veafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeglnvyd
    ivrterlvmdldawevfqnriggea
    

    Sequence, based on observed residues (ATOM records):
    >1vs9D (D:)
    ipvlspsgrrdvaadlpaeinphllwevvrwqlakrrrgtastktrgevaysgrkiwpqk
    htgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadraregklllvea
    fagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeglnvydivr
    terlvmdldawevf
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vs9E (E:)
    mpldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqel
    alitgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgl
    npnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpf
    rk
    

    Sequence, based on observed residues (ATOM records):
    >1vs9E (E:)
    ldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelal
    itgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnp
    nsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1vs9F (F:)
    msrigrlpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderr
    hkslhgltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppeg
    itfevpeptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagakk
    

    Sequence, based on observed residues (ATOM records):
    >1vs9F (F:)
    lpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderrhkslhg
    ltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppegitfevp
    eptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagak
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >1vs9G (G:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkkilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvvaqe
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1vs9H (H:)
    mvksslaflrgppiprqeqrralvktyvpkqveprwvlidaegktlgrlatkiatllrgk
    hrpdwtpnvamgdfvvvvnadkirvtgkkleqkiytrysgypgglkkiplekmlathper
    vlehavkgmlpkgplgrrlfkrlkvyagpdhphqaqrpeklev
    

    Sequence, based on observed residues (ATOM records):
    >1vs9H (H:)
    ktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadkir
    vtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrlk
    vyagpdhphqaqrpekl
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1vs9I (I:)
    miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavvkegdvvk
    avvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelregfmkivslape
    vl
    

    Sequence, based on observed residues (ATOM records):
    >1vs9I (I:)
    pqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavvkegdvvkavv
    vrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelregfmkivslap
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1vs9J (J:)
    mklsdlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlm
    rlpkrgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegea
    kplkvvahafsksaleklkaaggepvllea
    

    Sequence, based on observed residues (ATOM records):
    >1vs9J (J:)
    mklsdlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlm
    rlpkrgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegea
    kplkvvahafsksaleklkaaggepvl
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1vs9K (K:)
    mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrr
    ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
    aghklpiktkivrrdaydeaq
    

    Sequence, based on observed residues (ATOM records):
    >1vs9K (K:)
    mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrr
    ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
    aghklpiktkivrrday
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >1vs9L (L:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1vs9M (M:)
    marltayerrkfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkg
    nktevarqvgralaekalalgikqvafdrgpykyhgrvkalaegaregglef
    

    Sequence, based on observed residues (ATOM records):
    >1vs9M (M:)
    yerrkfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnkteva
    rqvgralaekalalgikqvafdrgpykyhgrvkalaegaregglef
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vs9N (N:)
    mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
    ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
    idkdraaeraakeevqkaqepeasqe
    

    Sequence, based on observed residues (ATOM records):
    >1vs9N (N:)
    galiklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfnttftv
    rkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklrad
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >1vs9O (O:)
    praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
    iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >1vs9P (P:)
    mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
    vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1vs9Q (Q:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhgk
    

    Sequence, based on observed residues (ATOM records):
    >1vs9Q (Q:)
    eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
    hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >1vs9R (R:)
    mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
    gkkkrlgrylgkrpdrkkaivqvapgqkiealegli
    

    Sequence, based on observed residues (ATOM records):
    >1vs9R (R:)
    mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
    gkkkrlgrylgkrpdrkkaivqvapgqkiealegl
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1vs9S (S:)
    mrvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggf
    iekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcggaldtee
    

    Sequence, based on observed residues (ATOM records):
    >1vs9S (S:)
    mrvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggf
    iekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcg
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1vs9T (T:)
    meyrlkayyregekpsalrragklpglmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklaeeaaaevaepevikkgkeeeee
    

    Sequence, based on observed residues (ATOM records):
    >1vs9T (T:)
    meyrlkayyregekpsalrragklpglmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklae
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1vs9U (U:)
    mahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlf
    alvdgvvefqdrgrlgryvhvrpla
    

    Sequence, based on observed residues (ATOM records):
    >1vs9U (U:)
    trngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvef
    qdrgrlgryvhvrpla
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >1vs9V (V:)
    mskvceisgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitf
    rvaashipkvyelverakglkleglspkeikkellkll
    

    Sequence, based on observed residues (ATOM records):
    >1vs9V (V:)
    qrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitfrvaashipkvyelverak
    glkleglspkeikkellk
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >1vs9W (W:)
    mrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarlltvln
    ekrrqna
    

    Sequence, based on observed residues (ATOM records):
    >1vs9W (W:)
    mrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarlltvln
    ekrr
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >1vs9X (X:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records:
    >1vs9Y (Y:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >1vs9Z (Z:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr
    

    Sequence, based on observed residues (ATOM records):
    >1vs9Z (Z:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpav
    

  • Chain 'a':
    Sequence; same for both SEQRES and ATOM records:
    >1vs9a (a:)
    pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
    lpr
    

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records:
    >1vs9b (b:)
    kvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

  • Chain 'w':
    No sequence available.

  • Chain 'x':
    No sequence available.