PDB entry 1vs3

View 1vs3 on RCSB PDB site
Description: crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8
Deposited on 2006-06-28, released 2006-12-12
The last revision was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.222
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA pseudouridine synthase A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: truA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: tRNA pseudouridine synthase A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: truA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1vs3A (A:)
    mrrllllceydgtlfaglqrqgrglrtvqgeleralpgigalpkavaagrtdagvhalam
    pfhvdvesaipvekvpealnrllpedlkvvgarevapdfharkdalwrayryrilvrphp
    spllrhralwvrrpldleameealslllgrhnflgfakeetrpgerellearlqvaegea
    glevrlyfrgksflrgqvrgmvgtllevglgkrppeslkailktadrrlagptapahgly
    fveaaypee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1vs3B (B:)
    mrrllllceydgtlfaglqrqgrglrtvqgeleralpgigalpkavaagrtdagvhalam
    pfhvdvesaipvekvpealnrllpedlkvvgarevapdfharkdalwrayryrilvrphp
    spllrhralwvrrpldleameealslllgrhnflgfakeetrpgerellearlqvaegea
    glevrlyfrgksflrgqvrgmvgtllevglgkrppeslkailktadrrlagptapahgly
    fveaaypee