PDB entry 1vs1

View 1vs1 on RCSB PDB site
Description: Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from Aeropyrum pernix in complex with Mn2+ and PEP
Deposited on 2006-03-09, released 2006-05-16
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-7-phosphoheptulonate synthase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: APE0581
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 3-deoxy-7-phosphoheptulonate synthase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: APE0581
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 3-deoxy-7-phosphoheptulonate synthase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: APE0581
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 3-deoxy-7-phosphoheptulonate synthase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: APE0581
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, PEP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vs1A (A:)
    mwrwlpvagfkgvklalkseerretvvevegvrigggskaviagpcsvesweqvreaala
    vkeagahmlrggafkprtspysfqglgleglkllrragdeaglpvvtevldprhvetvsr
    yadmlqigarnmqnfpllrevgrsgkpvllkrgfgntveellaaaeyillegnwqvvlve
    rgirtfepstrftldvaavavlkeathlpvivdpshpagrrslvpalakaglaagadgli
    vevhpnpeealsdakqqltpgefarlmgelrwhrll
    

    Sequence, based on observed residues (ATOM records):
    >1vs1A (A:)
    vagfkgvklalkseerretvvevegvrigggskaviagpcsvesweqvreaalavkeaga
    hmlrggafkprtspysfqglgleglkllrragdeaglpvvtevldprhvetvsryadmlq
    igarnmqnfpllrevgrsgkpvllkrgfgntveellaaaeyillegnwqvvlvergirtf
    epstrftldvaavavlkeathlpvivdpshpagrrslvpalakaglaagadglivevhpn
    peealsdakqqltpgefarlmgelrwhrll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vs1B (B:)
    mwrwlpvagfkgvklalkseerretvvevegvrigggskaviagpcsvesweqvreaala
    vkeagahmlrggafkprtspysfqglgleglkllrragdeaglpvvtevldprhvetvsr
    yadmlqigarnmqnfpllrevgrsgkpvllkrgfgntveellaaaeyillegnwqvvlve
    rgirtfepstrftldvaavavlkeathlpvivdpshpagrrslvpalakaglaagadgli
    vevhpnpeealsdakqqltpgefarlmgelrwhrll
    

    Sequence, based on observed residues (ATOM records):
    >1vs1B (B:)
    fkgvklalkseerretvvevegvrigggskaviagpcsvesweqvreaalavkeagahml
    rggafkprtspysfqglgleglkllrragdeaglpvvtevldprhvetvsryadmlqiga
    rnmqnfpllrevgrsgkpvllkrgfgntveellaaaeyillegnwqvvlvergirtfeps
    trftldvaavavlkeathlpvivdpshpagrrslvpalakaglaagadglivevhpnpee
    alsdakqqltpgefarlmgelrwhrll
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vs1C (C:)
    mwrwlpvagfkgvklalkseerretvvevegvrigggskaviagpcsvesweqvreaala
    vkeagahmlrggafkprtspysfqglgleglkllrragdeaglpvvtevldprhvetvsr
    yadmlqigarnmqnfpllrevgrsgkpvllkrgfgntveellaaaeyillegnwqvvlve
    rgirtfepstrftldvaavavlkeathlpvivdpshpagrrslvpalakaglaagadgli
    vevhpnpeealsdakqqltpgefarlmgelrwhrll
    

    Sequence, based on observed residues (ATOM records):
    >1vs1C (C:)
    gfkgvklalkseerretvvevegvrigggskaviagpcsvesweqvreaalavkeagahm
    lrggafkprtspysfqglgleglkllrragdeaglpvvtevldprhvetvsryadmlqig
    arnmqnfpllrevgrsgkpvllkrgfgntveellaaaeyillegnwqvvlvergirtfep
    strftldvaavavlkeathlpvivdpshpagrrslvpalakaglaagadglivevhpnpe
    ealsdakqqltpgefarlmgelrwhrll
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vs1D (D:)
    mwrwlpvagfkgvklalkseerretvvevegvrigggskaviagpcsvesweqvreaala
    vkeagahmlrggafkprtspysfqglgleglkllrragdeaglpvvtevldprhvetvsr
    yadmlqigarnmqnfpllrevgrsgkpvllkrgfgntveellaaaeyillegnwqvvlve
    rgirtfepstrftldvaavavlkeathlpvivdpshpagrrslvpalakaglaagadgli
    vevhpnpeealsdakqqltpgefarlmgelrwhrll
    

    Sequence, based on observed residues (ATOM records):
    >1vs1D (D:)
    pvagfkgvklalkseerretvvevegvrigggskaviagpcsvesweqvreaalavkeag
    ahmlrggafkprtspysfqglgleglkllrragdeaglpvvtevldprhvetvsryadml
    qigarnmqnfpllrevgrsgkpvllkrgfgntveellaaaeyillegnwqvvlvergirt
    fepstrftldvaavavlkeathlpvivdpshpagrrslvpalakaglaagadglivevhp
    npeealsdakqqltpgefarlmgelrwhrll