PDB entry 1vs0

View 1vs0 on RCSB PDB site
Description: Crystal Structure of the Ligase Domain from M. tuberculosis LigD at 2.4A
Deposited on 2006-01-27, released 2006-02-28
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative DNA ligase-like protein Rv0938/MT0965
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0938, MT0965
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71571 (Start-309)
      • modified residue (11)
      • modified residue (31)
      • modified residue (95)
      • modified residue (215)
      • modified residue (244)
  • Chain 'B':
    Compound: Putative DNA ligase-like protein Rv0938/MT0965
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0938, MT0965
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71571 (Start-309)
      • modified residue (11)
      • modified residue (31)
      • modified residue (95)
      • modified residue (215)
      • modified residue (244)
  • Heterogens: ZN, CL, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vs0A (A:)
    gavfefdnlapmlathgtvaglkasqwafegkwdgyrllveadhgavrlrsrsgrdvtae
    ypqlralaedladhhvvldgeavvldssgvpsfsqmqnrgrdtrvefwafdllyldgral
    lgtryqdrrklletlanatsltvpellpgdgaqafacsrkhgwegviakrrdsryqpgrr
    caswvkdkhwntqevviggwrageggrssgvgsllmgipgpgglqfagrvgtglserela
    nlkemlaplhtdespfdvplpardakgityvkpalvaevrysewtpegrlrqsswrglrp
    dkkpsevvre
    

    Sequence, based on observed residues (ATOM records):
    >1vs0A (A:)
    fefdnlapmlathgtvaglkasqwafegkwdgyrllveadhgavrlrsrsgrdvtaeypq
    lralaedladhhvvldgeavvldssgvpsfsqmqnrgrdtrvefwafdllyldgrallgt
    ryqdrrklletlanatsltvpellpgdgaqafacsrkhgwegviakrrdsryqpgrrcas
    wvkdkhwntqevviggwravgsllmgipgpgglqfagrvgtglserelanlkemlaplht
    despfdvplpardakgityvkpalvaevrysewtpegrlrqsswrglrpdkkpsevvre
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vs0B (B:)
    gavfefdnlapmlathgtvaglkasqwafegkwdgyrllveadhgavrlrsrsgrdvtae
    ypqlralaedladhhvvldgeavvldssgvpsfsqmqnrgrdtrvefwafdllyldgral
    lgtryqdrrklletlanatsltvpellpgdgaqafacsrkhgwegviakrrdsryqpgrr
    caswvkdkhwntqevviggwrageggrssgvgsllmgipgpgglqfagrvgtglserela
    nlkemlaplhtdespfdvplpardakgityvkpalvaevrysewtpegrlrqsswrglrp
    dkkpsevvre
    

    Sequence, based on observed residues (ATOM records):
    >1vs0B (B:)
    fefdnlapmlathgtvaglkasqwafegkwdgyrllveadhgavrlrsrsgrdvtaeypq
    lralaedladhhvvldgeavvldssgvpsfsqmqnrgrdtrvefwafdllyldgrallgt
    ryqdrrklletlanatsltvpellpgdgaqafacsrkhgwegviakrrdsryqpgrrcas
    wvkdkhwntqevviggwragegssgvgsllmgipgpgglqfagrvgtglserelanlkem
    laplhtdespfdvplpardakgityvkpalvaevrysewtpegrlrqsswrglrpdkkps
    evvre