PDB entry 1vrx

View 1vrx on RCSB PDB site
Description: Endocellulase e1 from acidothermus cellulolyticus mutant y245g
Class: hydrolase
Keywords: alpha/beta barrel, endo-1,4-beta-d-glucanase, hydrolase
Deposited on 2005-06-30, released 2005-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endocellulase e1 from a. cellulolyticus
    Species: Acidothermus cellulolyticus [TaxId:28049]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54583 (0-357)
      • engineered (244)
      • conflict (341)
    Domains in SCOPe 2.06: d1vrxa_
  • Chain 'B':
    Compound: endocellulase e1 from a. cellulolyticus
    Species: Acidothermus cellulolyticus [TaxId:28049]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54583 (0-357)
      • engineered (244)
      • conflict (341)
    Domains in SCOPe 2.06: d1vrxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vrxA (A:)
    agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
    irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
    sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
    aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
    atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
    qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vrxB (B:)
    agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
    irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
    sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
    aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
    atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
    qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv