PDB entry 1vrw

View 1vrw on RCSB PDB site
Description: Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with nadh
Class: oxidoreductase
Keywords: rossmann fold, short chain dehydrogenase reductase, nadh, oxidoreductase
Deposited on 2005-06-30, released 2005-07-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.176
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1vrwa1
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1vrwb_
  • Heterogens: NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vrwA (A:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntnq
    nknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkllstdigsvas
    fllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrwA (A:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkytfidyaieys
    ekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vrwB (B:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntnq
    nknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkllstdigsvas
    fllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrwB (B:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkytfidyaieys
    ekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd