PDB entry 1vru

View 1vru on RCSB PDB site
Description: high resolution structures of hiv-1 rt from four rt-inhibitor complexes
Class: nucleotidyltransferase
Keywords: hiv-1 reverse transcriptase, nucleotidyltransferase
Deposited on 1995-04-19, released 1996-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.187
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 POL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vrua1, d1vrua2
  • Chain 'B':
    Compound: hiv-1 reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 POL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vrub_
  • Heterogens: AAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vruA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vruA (A:)
    spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
    ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde
    dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyq
    ymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvq
    pivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaele
    laenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgaht
    ndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntppl
    vklwyqlekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglev
    nivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vruB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vruB (B:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
    kkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplded
    frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqy
    mddlyvgsdleigqhrtkieelrqhllrwglttpgyelhpdkwtvqpivlpekdswtvnd
    iqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhg
    vyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyargahtndvkqlteavqkitte
    siviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq