PDB entry 1vrs

View 1vrs on RCSB PDB site
Description: Crystal structure of the disulfide-linked complex between the N-terminal and C-terminal domain of the electron transfer catalyst DsbD
Class: oxidoreductase
Keywords: DsbD, immunoglobulin-like, thioredoxin-like, disulfide-linked, OXIDOREDUCTASE
Deposited on 2005-06-17, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: DSBD, DIPZ, CYCZ, CUTA2, B4136
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655 (0-End)
      • engineered (102)
    Domains in SCOPe 2.07: d1vrsa_
  • Chain 'B':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: DSBD, DIPZ, CYCZ, CUTA2, B4136
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655 (0-End)
      • engineered (102)
    Domains in SCOPe 2.07: d1vrsb_
  • Chain 'C':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: DSBD, DIPZ, CYCZ, CUTA2, B4136
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655
      • engineered (102)
    Domains in SCOPe 2.07: d1vrsc_
  • Chain 'D':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: DSBD, DIPZ, CYCZ, CUTA2, B4136
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655
      • engineered (45)
    Domains in SCOPe 2.07: d1vrsd_
  • Chain 'E':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: DSBD, DIPZ, CYCZ, CUTA2, B4136
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655
      • engineered (45)
    Domains in SCOPe 2.07: d1vrse_
  • Chain 'F':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: DSBD, DIPZ, CYCZ, CUTA2, B4136
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655
      • engineered (45)
    Domains in SCOPe 2.07: d1vrsf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vrsA (A:)
    glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
    pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
    evvannaapqpvsvpqqeqptaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrsA (A:)
    glfdaqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgv
    whedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplsevva
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vrsB (B:)
    glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
    pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
    evvannaapqpvsvpqqeqptaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrsB (B:)
    glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
    pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
    evvan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vrsC (C:)
    glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
    pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
    evvannaapqpvsvpqqeqptaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrsC (C:)
    sqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhed
    efygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vrsD (D:)
    athtaqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvq
    kaladtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfs
    ahlrdrqphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrsD (D:)
    hlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtvll
    qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vrsE (E:)
    athtaqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvq
    kaladtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfs
    ahlrdrqphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrsE (E:)
    qthlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtv
    llqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vrsF (F:)
    athtaqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvq
    kaladtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfs
    ahlrdrqphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrsF (F:)
    hlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtvll
    qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrq