PDB entry 1vrr

View 1vrr on RCSB PDB site
Description: Crystal structure of the restriction endonuclease BstYI complex with DNA
Class: hydrolase/DNA
Keywords: Enzyme-DNA complex, double helix, hydrolase/DNA COMPLEX
Deposited on 2005-06-02, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BstYI
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: bstYIR
    Database cross-references and differences (RAF-indexed):
    • GB AAO48714 (0-202)
    Domains in SCOPe 2.07: d1vrra_
  • Chain 'B':
    Compound: BstYI
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: bstYIR
    Database cross-references and differences (RAF-indexed):
    • GB AAO48714 (0-202)
    Domains in SCOPe 2.07: d1vrrb_
  • Chain 'C':
    Compound: 5'-d(*tp*tp*ap*tp*ap*gp*ap*tp*cp*tp*ap*tp*ap*a)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*tp*ap*tp*ap*gp*ap*tp*cp*tp*ap*tp*ap*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vrrA (A:)
    mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskektkqgqilyspval
    neafkekleakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdf
    vkdrvaievqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyege
    lynvirqgrgvpavplvligiap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vrrB (B:)
    mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskektkqgqilyspval
    neafkekleakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdf
    vkdrvaievqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyege
    lynvirqgrgvpavplvligiap
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.