PDB entry 1vrq

View 1vrq on RCSB PDB site
Description: Crystal Structure of Heterotetrameric Sarcosine Oxidase from Corynebacterium sp. U-96 in complex with Folinic Acid
Deposited on 2005-04-27, released 2005-07-05
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sarcosine oxidase alpha subunit
    Species: Corynebacterium sp. [TaxId:31944]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sarcosine oxidase beta subunit
    Species: Corynebacterium sp. [TaxId:31944]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Sarcosine oxidase gamma subunit
    Species: Corynebacterium sp. [TaxId:31944]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Sarcosine oxidase delta subunit
    Species: Corynebacterium sp. [TaxId:31944]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, SO4, FAD, NAD, FON, FMN, DMG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vrqA (A:)
    skpqrlsaaqtagarinrdealtltvdgqqlsafrgdtvasamlanglrscgnsmyldrp
    rgifsagveepnalitvgarhqadinesmlpattvsvtdglnatllsglgvldpsedpay
    ydhvhvhtdvlvvgagpaglaaareasrsgarvmllderpeaggtlreasgeqidgidaa
    qwidavteelaaaeetthlqrttvfgsydanyilaaqrrtvhldgpsgqgvsreriwhir
    akqvvlataaherpivfenndrpgimlagsvrsylnrfgvragskiavattndsvyplvs
    elaasggvvavidarqnisaaaaqavtdgvtvltgsvvanteadasgelsavlvatldeq
    rnlgeaqrfeadvlavsggfnpvvhlhsqrqgklnwdtsihafvpadavanqhlagaltg
    lldtasalstgaatgaaaasaagfekiaevpqalavpagetrpvwlvpslsgddavhykf
    hfvdlqrdqtvadvlratgagmqsvehikrytsistandqgktsgvaaigviaavlgien
    paqigtttfrapytpvsfaalagrtrgelldparltamhpwhlahgakfedvgqwkrpwy
    ypqdgesmdeavyreckavrdsvgmldastlgkieirgkdaaeflnrmytngytklkvgm
    grygvmckadgmifddgvtlrlaedrflmhtttggaadvldwleewlqtewpeldvtcts
    vteqlatvavvgprsrdviaklassldvsndafkfmafqdvtldsgiearisrisfsgel
    afeiaipawhglqvwedvyaagqefnitpygtetmhvlraekgfiivgqdtdgtvtpqda
    gmewvvsklkdfvgkrsfsrednvredrkhlvsvlpvdsslrlaegaalvaadavasegv
    tpmegwvthaynspalgrtfglalikngrnrigevlktpvdgqlvdvqvsdlvlfdpegs
    rrdg
    

    Sequence, based on observed residues (ATOM records):
    >1vrqA (A:)
    skpqrlsaaqtagarinrdealtltvdgqqlsafrgdtvasamlanglrscgnsmyldrp
    rgifsagveepnalitvgarhqadinesmlpattvsvtdglnatllsglgvldpsedpay
    ydhvhvhtdvlvvgagpaglaaareasrsgarvmllderpeaggtlreasgeqidgidaa
    qwidavteelaaaeetthlqrttvfgsydanyilaaqrrtvhldgpsgqgvsreriwhir
    akqvvlataaherpivfenndrpgimlagsvrsylnrfgvragskiavattndsvyplvs
    elaasggvvavidarqnisaaaaqavtdgvtvltgsvvanteadasgelsavlvatldeq
    rnlgeaqrfeadvlavsggfnpvvhlhsqrqgklnwdtsihafvpadavanqhlagaltg
    lldtasalstgaatgaaaasaagfekiaevpqalavpagetrpvwlvpslsgddavhykf
    hfvdlqrdqtvadvlratgagmqsvehikrytsistandqgktsgvaaigviaavlgien
    paqigtttfrapytpvsfaalagrtrgelldparltamhpwhlahgakfedvgqwkrpwy
    ypqdgesmdeavyreckavrdsvgmldastlgkieirgkdaaeflnrmytngytklkvgm
    grygvmckadgmifddgvtlrlaedrflmhtttggaadvldwleewlqtewpeldvtcts
    vteqlatvavvgprsrdviaklassldvsndafkfmafqdvtldsgiearisrisfsgel
    afeiaipawhglqvwedvyaagqefnitpygtetmhvlraekgfiivgqdtdgtvtpqda
    gmewvvsklkdfvgkrsfsrednvredrkhlvsvlpvdsslrlaegaalvaadavasegv
    tpmegwvthaynspalgrtfglalikngrnrigevlktpvdgqlvdvqvsdlvlfdpegs
    rrd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vrqB (B:)
    adllpehpeflwnnpepkksydvvivgggghglatayylaknhgitnvavlekgwlaggn
    marnttiirsnylwdesagiyekslklweelpeeleydflfsqrgvlnlahtlgdvresi
    rrveankfngvdaewltpeqvkevcpiintgdnirypvmgatyqpragiakhdhvawafa
    rkanemgvdiiqncevtgflkdgekvtgvkttrgtilagkvalagaghssvlaelagfel
    piqshplqalvselfepvhptvvmsnhihvyvsqahkgelvmgagidsyngygqrgafhv
    ieeqmaaavelfpifarahvlrtwggivdttmdaspiisktpiqnlyvncgwgtggfkgt
    pgagytlahtiahdephklnapfalerfetghlidehgaaavah
    

    Sequence, based on observed residues (ATOM records):
    >1vrqB (B:)
    adllpehpeflwnnpepkksydvvivgggghglatayylaknhgitnvavlekgwlaggn
    marnttiirsnylwdesagiyekslklweelpeeleydflfsqrgvlnlahtlgdvresi
    rrveankfngvdaewltpeqvkevcpiintgdnirypvmgatyqpragiakhdhvawafa
    rkanemgvdiiqncevtgflkdgekvtgvkttrgtilagkvalagaghssvlaelagfel
    piqshplqalvselfepvhptvvmsnhihvyvsqahkgelvmgagidsyngygqrgafhv
    ieeqmaaavelfpifarahvlrtwggivdttmdaspiisktpiqnlyvncgwgtggfkgt
    pgagytlahtiahdephklnapfalerfetghlidehgaaav
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vrqC (C:)
    midstqlrrspaahlaaameaaevageravtlrevafttqlglravpgstghaalaaatg
    vglpaavgevagdvsgtavlwlgpdefllaaeenpalldtlqgalgqepgqvldlsanrs
    vlqlegpaaalvlrkscpadlhprefgvnraittslanipvllwrtgeqswrilprasft
    ehtvhwlidamsefsaaevahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1vrqC (C:)
    qlrrspaahlaaameaaevageravtlrevafttqlglravpgstghaalaaatgvglpa
    avgevagdvsgtavlwlgpdefllaaeenpalldtlqgalgqepgqvldlsanrsvlqle
    gpaaalvlrkscpadlhprefgvnraittslanipvllwrtgeqswrilprasftehtvh
    wlidamsefsaaeva
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vrqD (D:)
    mmliecpncgprnenefkyggeahvaypedpnalsdkewsrylfyrgnkkgifaerwvhs
    ggcrkwfnalrdtvsyefkavyragearpqldsteggtr
    

    Sequence, based on observed residues (ATOM records):
    >1vrqD (D:)
    mmliecpncgprnenefkyggeahvaypedpnalsdkewsrylfyrgnkkgifaerwvhs
    ggcrkwfnalrdtvsyefkavyragearpql