PDB entry 1vrl

View 1vrl on RCSB PDB site
Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base
Class: hydrolase/DNA
Keywords: DNA repair, DNA glycosylase, 8-oxoguanine, protein-DNA complex
Deposited on 2005-03-08, released 2005-03-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutY
    Species: Bacillus stearothermophilus
    Gene: mutY
    Domains in SCOP 1.73: d1vrla1, d1vrla2
  • Chain 'B':
    Compound: 5'-d(*ap*ap*gp*ap*cp*(8og)p*tp*gp*gp*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(*tp*gp*tp*cp*cp*ap*(hpd)p*gp*tp*cp*t)-3'
  • Heterogens: CA, SF4, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vrlA (A:)
    gshmtreterfparefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipy
    feqfidrfptlealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdef
    srlkgvgpytvgavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivrei
    mayenpgafnealielgalvctprrpscllcpvqaycqafaegvaeelpvkmkktavkqv
    plavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglqvelt
    epivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyke
    wasgvrppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrlA (A:)
    parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
    ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
    gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
    alielgalvctprrpscllcpvqaycqafaegvaeelpvkmkktavkqvplavavladde
    grvlirkrdstgllanlwefpscetddgkekleqmvglqveltepivsfehafshlvwql
    tvfpgrlvhggpveepyrlapedelkayafpvshqrvwreykewas
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.