PDB entry 1vrk

View 1vrk on RCSB PDB site
Description: the 1.9 angstrom structure of e84k-calmodulin rs20 peptide complex
Class: complex(calcium-binding protein/peptide)
Keywords: calmodulin, calcium binding, helix-loop-helix, signalling, complex(calcium-binding protein/peptide)
Deposited on 1997-09-24, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • GB AAC61858 (0-147)
    Domains in SCOPe 2.07: d1vrka_
  • Chain 'B':
    Compound: rs20
    Database cross-references and differences (RAF-indexed):
    • PDB 1VRK (0-End)
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vrkA (A:)
    adqltdeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpeflnlmarkmkdtdseeklkeafrvfdkdgngfisaaelrhvmtnlgekltdee
    vdemireadvdgdgqvnyeefvqvmmak
    

  • Chain 'B':
    No sequence available.