PDB entry 1vre

View 1vre on RCSB PDB site
Description: solution structure of component IV glycera dibranchiata monomeric hemoglobin-co
Class: heme protein
Keywords: heme protein, globin, oxygen transport
Deposited on 1999-03-25, released 1999-04-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (globin, monomeric component m-IV)
  Species: Glycera dibranchiata [TaxId:6350]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15447 (0-146)
  Domains in SCOPe 2.04: d1vrea_
• Heterogens: HEM, CMO

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vreA (A:)
  glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
  kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
  kmnaaakdawaaayadisgalisglqs