PDB entry 1vrd

View 1vrd on RCSB PDB site
Description: Crystal structure of Inosine-5'-monophosphate dehydrogenase (TM1347) from THERMOTOGA MARITIMA at 2.18 A resolution
Class: oxidoreductase
Keywords: TM1347, Inosine-5'-monophosphate dehydrogenase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, OXIDOREDUCTASE
Deposited on 2005-02-22, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.219
AEROSPACI score: -1.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vrda1
  • Chain 'B':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vrdb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vrdA (A:)
    mgsdkihhhhhhmkealtfddvllvpqysevlpkdvkidtrltrqiriniplvsaamdtv
    teaalakalareggigiihknltpdeqarqvsivkktengiiydpitvtpdmtvkeaidl
    maeykigglpvvdeegrlvglltnrdvrfeknlskkikdlmtpreklivappdislekak
    eilhqhrieklplvskdnklvglitikdimsviehpnaardekgrllvgaavgtspetme
    rveklvkagvdvividtahghsrrvietlemikadypdlpvvagnvatpegtealikaga
    davkvgvgpgsicttrvvagvgvpqltavmecsevarkydvpiiadggirysgdivkala
    agaesvmvgsifagteeapgetilyqgrkykayrgmgslgamrsgsadrygqegenkfvp
    egiegmvpykgtvkdvvhqlvgglrsgmgyigartikelqekavfvkitpagvkeshphd
    iiitkespnywvqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrdA (A:)
    mkealtfddvllvpqysevlpkdvkidtrltrqiriniplvsaamdtvteaalakalare
    ggigiihknltpdeqarqvsivkktimsviehpnaardekgrllvgaavgtspetmerve
    klvkagvdvividtahghsrrvietlemikadypdlpvvagnvatpegtealikagadav
    kvgvgpgsicttrvvagvgvpqltavmecsevarkydvpiiadggirysgdivkalaaga
    esvmvgsifagteeapgetilyqgrkykayrgmgiegmvpykgtvkdvvhqlvgglrsgm
    gyigartikelqekavfvkit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vrdB (B:)
    mgsdkihhhhhhmkealtfddvllvpqysevlpkdvkidtrltrqiriniplvsaamdtv
    teaalakalareggigiihknltpdeqarqvsivkktengiiydpitvtpdmtvkeaidl
    maeykigglpvvdeegrlvglltnrdvrfeknlskkikdlmtpreklivappdislekak
    eilhqhrieklplvskdnklvglitikdimsviehpnaardekgrllvgaavgtspetme
    rveklvkagvdvividtahghsrrvietlemikadypdlpvvagnvatpegtealikaga
    davkvgvgpgsicttrvvagvgvpqltavmecsevarkydvpiiadggirysgdivkala
    agaesvmvgsifagteeapgetilyqgrkykayrgmgslgamrsgsadrygqegenkfvp
    egiegmvpykgtvkdvvhqlvgglrsgmgyigartikelqekavfvkitpagvkeshphd
    iiitkespnywvqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrdB (B:)
    mkealtfddvllvpqysevlpkdvkidtrltrqiriniplvsaamdtvteaalakalare
    ggigiihknltpdeqarqvsivksviehpnaardekgrllvgaavgtspetmerveklvk
    agvdvividtahghsrrvietlemikadypdlpvvagnvatpegtealikagadavkvgv
    gpgsicttrvvagvgvpqltavmecsevarkydvpiiadggirysgdivkalaagaesvm
    vgsifagteeapgetilyqgrkykayrgmgiegmvpykgtvkdvvhqlvgglrsgmgyig
    artikelqekavfvkit